%PDF-1.4 % 1197 0 obj << /Linearized 1 /O 1200 /H [ 2185 1111 ] /L 1239071 /E 59995 /N 28 /T 1215011 >> endobj xref 1197 79 0000000016 00000 n 0000001935 00000 n 0000002143 00000 n 0000003296 00000 n 0000004363 00000 n 0000004433 00000 n 0000004529 00000 n 0000004686 00000 n 0000004793 00000 n 0000004912 00000 n 0000005048 00000 n 0000005237 00000 n 0000005348 00000 n 0000005474 00000 n 0000005655 00000 n 0000005760 00000 n 0000005868 00000 n 0000006061 00000 n 0000006178 00000 n 0000006291 00000 n 0000006469 00000 n 0000006613 00000 n 0000006757 00000 n 0000006940 00000 n 0000007049 00000 n 0000007147 00000 n 0000007305 00000 n 0000007417 00000 n 0000007535 00000 n 0000007705 00000 n 0000007819 00000 n 0000007948 00000 n 0000008061 00000 n 0000008224 00000 n 0000008267 00000 n 0000008298 00000 n 0000008322 00000 n 0000010815 00000 n 0000010839 00000 n 0000013189 00000 n 0000013213 00000 n 0000015825 00000 n 0000015849 00000 n 0000018540 00000 n 0000018564 00000 n 0000021635 00000 n 0000021659 00000 n 0000021962 00000 n 0000023189 00000 n 0000023396 00000 n 0000024214 00000 n 0000027183 00000 n 0000027207 00000 n 0000029518 00000 n 0000029542 00000 n 0000029637 00000 n 0000029845 00000 n 0000050976 00000 n 0000051104 00000 n 0000053783 00000 n 0000054425 00000 n 0000057556 00000 n 0000057650 00000 n 0000057744 00000 n 0000057839 00000 n 0000057933 00000 n 0000058028 00000 n 0000058122 00000 n 0000058217 00000 n 0000058311 00000 n 0000058405 00000 n 0000058500 00000 n 0000058594 00000 n 0000058689 00000 n 0000058783 00000 n 0000058878 00000 n 0000059323 00000 n 0000002185 00000 n 0000003273 00000 n trailer << /Size 1276 /Info 1196 0 R /Root 1198 0 R /Prev 1214999 /ID[] >> startxref 0 %%EOF 1198 0 obj << /PageMode /UseOutlines /Names 1199 0 R /Outlines 1201 0 R /Metadata 1191 0 R /Pages 1192 0 R /OpenAction [ 1200 0 R /XYZ null null null ] /Type /Catalog /PageLabels 1189 0 R >> endobj 1199 0 obj << /Dests 471 0 R >> endobj 1274 0 obj << /S 931 /O 1327 /E 1343 /L 1359 /Filter /FlateDecode /Length 1275 0 R >> stream HS]lUݥ ig&2fpg:}V(RgfgwCaii-TZa-?`$hB41&J$Dva5ɹc7E`w}y/LC#;?ZN:F6|LuJ5]_c62wa[j+O^n?O֭/ -G"}哭=Mg/hZTfQsM &ڎL15[e$Fef(-JsE52q&TŐMGĘE]qCV${ ,NmגtS[%=*hڂ#lU3%#ik*L`{.I?ߧ*2ߗ:Яk.S 9\ی kԴ1l3TlG CA} >$b&a琡*lKcCGMwt3d3fk7מ;H:.֖m|d݌/L&mi3OH/Ã̬Ᵽ#|;ĎOSR78_ɮᣙT3N̛}b>wꭷyS=˲O VH#Ndޭ< ῱EgZyP XYȼHmЅCA.U8uMެQ.sz7>$Rڇ*zDnFzuT.*xz?|"^zW|T4L]ď[9'_#<{ R)t endstream endobj 1275 0 obj 976 endobj 1200 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1193 0 R /Contents [ 1233 0 R 1235 0 R 1237 0 R 1239 0 R 1241 0 R 1247 0 R 1249 0 R 1257 0 R ] /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS26 1231 0 R /CS27 1230 0 R /CS24 1231 0 R /CS25 1230 0 R /CS22 1231 0 R /CS23 1230 0 R /CS20 1231 0 R /CS21 1230 0 R /CS18 1231 0 R /CS19 1230 0 R /CS16 1231 0 R /CS17 1230 0 R /CS14 1231 0 R /CS15 1230 0 R /CS12 1231 0 R /CS13 1230 0 R /CS10 1231 0 R /CS11 1230 0 R /CS8 1231 0 R /CS9 1230 0 R /CS6 1231 0 R /CS7 1230 0 R /CS4 1231 0 R /CS5 1230 0 R /CS2 1231 0 R /CS3 1230 0 R /CS0 1231 0 R /CS1 1230 0 R /Cs6 1230 0 R >> /ExtGState << /GS208 1251 0 R /GS209 1258 0 R /GS210 1259 0 R /GS211 1260 0 R /GS212 1261 0 R /GS213 1262 0 R /GS214 1263 0 R /GS215 1264 0 R /GS216 1252 0 R /GS217 1265 0 R /GS218 1266 0 R /GS219 1267 0 R /GS220 1268 0 R /GS221 1269 0 R /GS222 1270 0 R /GS223 1271 0 R >> /Shading << /Sh26 1273 0 R /Sh27 1254 0 R >> /Font << /TT27 1244 0 R /TT28 1246 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 1201 0 obj << /First 1202 0 R /Count 11 /Last 1203 0 R >> endobj 1202 0 obj << /Parent 1201 0 R /Next 1222 0 R /Dest (G3.803851) /Title (o ndice) >> endobj 1203 0 obj << /First 1204 0 R /Parent 1201 0 R /Dest (G6.816636) /Count -2 /Last 1205 0 R /Prev 1206 0 R /Title (7. Aplicativos Fornecidos) >> endobj 1204 0 obj << /Parent 1203 0 R /Next 1205 0 R /Dest (G6.816640) /Title (o ScanFront Service) >> endobj 1205 0 obj << /Parent 1203 0 R /Dest (G6.816672) /Prev 1204 0 R /Title (o ScanFront Administration Tool) >> endobj 1206 0 obj << /Parent 1201 0 R /Next 1203 0 R /Dest (G6.816493) /Prev 1207 0 R /Title (6. Procedimento de Digitalizao) >> endobj 1207 0 obj << /First 1208 0 R /Parent 1201 0 R /Next 1206 0 R /Dest (G6.816302) /Count -3 /Last 1209 0 R /Prev 1210 0 R /Title (5. Definio das Configuraes do Scanner) >> endobj 1208 0 obj << /Parent 1207 0 R /Next 1229 0 R /Dest (G6.816327) /Title (o Configuraes da Rede) >> endobj 1209 0 obj << /Parent 1207 0 R /Dest (G6.816482) /Prev 1229 0 R /Title (o Configuraes do Servidor de Correio) >> endobj 1210 0 obj << /First 1211 0 R /Parent 1201 0 R /Next 1207 0 R /Dest (G6.816266) /Count -2 /Last 1212 0 R /Prev 1213 0 R /Title (4. Ligando e Desligando a Energia) >> endobj 1211 0 obj << /Parent 1210 0 R /Next 1212 0 R /Dest (G6.816270) /Title (o Ligar a Energia) >> endobj 1212 0 obj << /Parent 1210 0 R /Dest (G6.816287) /Prev 1211 0 R /Title (o Desligar a Energia) >> endobj 1213 0 obj << /First 1214 0 R /Parent 1201 0 R /Next 1210 0 R /Dest (G6.816224) /Count -2 /Last 1215 0 R /Prev 1216 0 R /Title (3. Instalao do Scanner e Conexo a uma Rede) >> endobj 1214 0 obj << /Parent 1213 0 R /Next 1215 0 R /Dest (G6.1079800) /Title (o Conexo do Adaptador de CA) >> endobj 1215 0 obj << /Parent 1213 0 R /Dest (G6.816257) /Prev 1214 0 R /Title (o Conexo do Cabo de Rede) >> endobj 1216 0 obj << /Parent 1201 0 R /Next 1213 0 R /Dest (G6.816154) /Prev 1217 0 R /Title (2. Remoo do Material de Embalagem e Colocao do Rolete de Alimentao\ ) >> endobj 1217 0 obj << /Parent 1201 0 R /Next 1216 0 R /Dest (G6.816145) /Prev 1218 0 R /Title (1. Verificao dos Acessrios Fornecidos) >> endobj 1218 0 obj << /Parent 1201 0 R /Next 1217 0 R /Dest (G6.816051) /Prev 1219 0 R /Title (Viso Geral da Configurao do ScanFront) >> endobj 1219 0 obj << /First 1220 0 R /Parent 1201 0 R /Next 1218 0 R /Dest (G5.973661) /Count -6 /Last 1221 0 R /Prev 1222 0 R /Title (Instrues Importantes de Segurana) >> endobj 1220 0 obj << /Parent 1219 0 R /Next 1228 0 R /Dest (G5.973669) /Title (o Local de Instalao) >> endobj 1221 0 obj << /Parent 1219 0 R /Dest (G5.973816) /Prev 1225 0 R /Title (o Descarte) >> endobj 1222 0 obj << /First 1223 0 R /Parent 1201 0 R /Next 1219 0 R /Dest (G4.389948) /Count -2 /Last 1224 0 R /Prev 1202 0 R /Title (Introduo) >> endobj 1223 0 obj << /Parent 1222 0 R /Next 1224 0 R /Dest (G4.389969) /Title (o Manuais para o Scanner) >> endobj 1224 0 obj << /Parent 1222 0 R /Dest (G4.389996) /Prev 1223 0 R /Title (o Smbolos Usados neste Manual) >> endobj 1225 0 obj << /Parent 1219 0 R /Next 1221 0 R /Dest (G5.973792) /Prev 1226 0 R /Title (o Sobre o Sensor de Impresso Digital \(Somente o ScanFront 300P\)) >> endobj 1226 0 obj << /Parent 1219 0 R /Next 1225 0 R /Dest (G5.973730) /Prev 1227 0 R /Title (o Manuseio) >> endobj 1227 0 obj << /Parent 1219 0 R /Next 1226 0 R /Dest (G5.973722) /Prev 1228 0 R /Title (o Movimentao do Scanner) >> endobj 1228 0 obj << /Parent 1219 0 R /Next 1227 0 R /Dest (G5.973698) /Prev 1220 0 R /Title (o Energia) >> endobj 1229 0 obj << /Parent 1207 0 R /Next 1209 0 R /Dest (G6.816401) /Prev 1208 0 R /Title (o Configurao da Data e Hora e Confirmao do Fuso Horrio) >> endobj 1230 0 obj [ /ICCBased 1255 0 R ] endobj 1231 0 obj /DeviceGray endobj 1232 0 obj 2411 endobj 1233 0 obj << /Filter /FlateDecode /Length 1232 0 R >> stream HlWˮd Wցa @1d=7᱑~(^q(Dݛ}x?z_.(t﷘ɏZT]뮖Cu_?~v# Qs/fA~|b~s~ErsD?b"_-q:b7w=n>}V?_/ Nא}Rh> 5Z,&ȼWRt%q6F~rGVS;J,c-ƅV}tHt½n1{٭3Rc̒[H ^5K9Z8%^/uxMmHmn&tEc8C7J;tSByu)֎1[=sc]}Ŝ{[N|NZ7k t 4R8ͪ`e@ EvhcR=dv|l2!G%;~zb;hm% j=K5%aF [S|2i2w-몳 *+!MБf,lX6*gf ,\ӱdP!M~]|d霌_츶9puɘ x9'@R}ida0/+5'mw_[$%=,p(/I$fXHB֘x"Cʳ{Utn7ڴw3T錛7\9ÁMq/>k֘قnM 8F=0KLY;zJ5j`28鐫5V>b*PM=p\8N jV*O.KZr)\}1/@f35Yqyug4ӄnE!DŽ2EiG5n|Ob ##Ab'8+ 3f4(ժ -Z-̕j*"w5'!%aK8ԖL 6PLM{\˼!mr {|:R~O.cdjb2)U`T1i[ҟ5f`-L$LB21LB ut;1+9%txdX t0%~ױȚPG72 -=iS"0b?,skZccxgO0ͩ\~[_Dt`jO NcN^_e'3% ɘƗt~_tqK=0" {v yRgUeė85ͯ_F}>% Cy/|>%"A+O'tb[(]ofEFAXl՜w`cA({Ls,T}{ 䗻=Qc%u7pU0\IQ_1/|܆dޫ0Y_1VMgY%nITAyN]ebBGd4{H}S_!7E =7Ԙ9dX^հ$f37vf!_E'ܵI)> stream HlWA )n*_ļv{1ѓׇ)_5HyW͜&/֨40F0?k!$Qh9=1)32%xtnTns*:T3|5VkrO=qM`+M5qaJÈ:_YmVm7)fVŝŐm]Da$3u^{O5zK ϲrn!U9&iiV Q*oA-LTی>+sy[MKNB6 0=h! 'µ.EܦRͯ &z*w`oFNH{&8}tx!#\\>B#q Pu1>sJ^ͱs1qQ5u(ų&='-2<J;NC+1Vz6tElM^7Fs{j\B3e|fʙR4Smkkb[6Q#|Eϯ:DpMeEq _ qRp`x7RbluN3G8N\ )l`{NJATޗ/iQՠIuQfJh)b죏>PڎjG7rڹl%۪A=;vVUSG};3{_G?C!|!+! 3; 4iđ1?> a3!۪wKf;{e!xXwY7U1U‘!|؈8o^5`ֈ>!C ‡Ql_va>"V$2 5ԉ_{J1,8~QMdmDQ2"$I\(`Gֶ{X_]wߗ[`MY5R98\so[\t:Ϳ[}Z >SeΎ~jƋ`0 5vh\xg0.™%.UY[죜Eܸ|m#^DUw`8z!sxAD;pJ@+ѵzDfpDh+rs[Tm%7CĀmtd^ۀ`k!Ef9oX A "F;0luc Q C֥ra*}3u?0kH71OaSfWb`GڨY0.10}~j uYT,g0zIuܓlhCcN'gN*nz XJ?bYP@f +hToE܏^ md*WjFIRGXO-ьW8V#/V֡GzAZ> O.#2XKwmbiLQVeUm"Jh7GB)2@wZ" f&Rsl|:sh4;x6 UN6;0^4XD3j#-`ҷUk#[o=)哱0RG1Q]5,r؎fށ5Clt[`W"4_ #ʝwGpCiNAv|iӰ.g3RL;t g4Oȋm]e,auڰ*:ĜHwO1|?M! mr?"{]B:b[4f&|~zƬey&`,t7[&x#֊"ݓn38Vz:1ށu.n̫ˉ]X3lr> stream HlW9vD u>7p}9s ;hnfkIUI@aWIIjg"nS-{:__˞:^3|+T+ɳc|ӭcd{RϯYJl8xC7|԰!JK;\c[2nϽȍߠ&X[{JJ*0&<Ǣm$Le$ҾLcI(딍G>Dt.&—@s;a u12GvtIi.*? T *O5_ABҖ`~./U˼W}iwb ֡ ]Q5fgU ُf INՙGOT)f oZ;` ٗdsj C+kS܆ط)-(ymDMnXMafQ;̹W0F`#- Lʼn?/^wsܿGcg%s aŌ'8[le13pNbSQ/8TR+f >c38S pVn=8][|FLUoQ1i+8̐a:KuL `JGG>aPR \8\О}&gnJe)HwbJq09BS 1Im`.mAx$#2fNK2`̘ x9"A^dUHk\{@Գ3=_5ΉâTX"MbkI:@Jl~vΊAl3 6g߹X`8d)>E6ORr\C ;[Tł3y43f͓,7lQېi33z|0RjܣPH4MUi/"=s|4[( u}􃑬Q`NјeM  0t:8bRl0]''آzM$tu.Bj&[(} (2 auBU ձW>&\egZV3`;8)4}<"DkE.b(2#8tR3 %Ɔgz1\BdFX3x'‹#58rTĹ9c5o,NdErJ&&U0ScQ;ӈŤ#u/R!FSF* ˻)C7_4z:zgpm"uxh`~ fROX;Sj:ˋ5vǝeyvfhѼf^yM _9GijF.L]CB!z3 hOemni!:oF~*`2W!3tO<ԡ3җW^AeyΝκl>t3yӞ?ӘABK5v;#ʬa|ABVP$?lj>(-=( C|m] E ݕ%EY. 9sν R:&YQEbs3,y.]Y|la^%ոY~2t1VތSH IJ4nv4΂ًMx%1|ܽf>܀ Vʔ[-8"lsy!*ٿɕЅu7/v X|-sV=/g%yGM=N *i^=ii +K]{AIä@u/,G(M)ɋsvf}pu/O˕q!E)wNR6bJW3G StJڻtbpܠB֭ 6t`bĉ_d(n^QK5 kJz\>N<˲|٪k;d߾Wf'u'R[#\|dpuF730GjĚ8}'(c endstream endobj 1238 0 obj 2609 endobj 1239 0 obj << /Filter /FlateDecode /Length 1238 0 R >> stream HlW͊47S ,)%t5=gY0LUg|z"JJ_Lsr^NXϑ 4z=29W0 )h:Ect"`Y8rgnX3|ah)y3M ct 2uiĮmM?4z|BXp1?1ipf ӰTJ(4&ڊ:hvV”ȴgՉ)woО:ON mCB^ΩrW:hL g麭ow( ۆ sЩ4aؑ]TI34/|.dT>(L|c5.UnZB.uiÕeuF\9 L2 u3p19\jr4\WsFpF\fqFh$:*SBBIL:oaNT!͸w`fW蟆ni:iəŢ31TOKk zp< ۳Nb(k59,spiwr nX- tKa6l̨jņLd؂bƎkd2}Tõ.[PkĒh+j -Z OŽEhIQ?~bZZ7c_JM,~xԑϫB A^~*^ Ys6#f*iSwȲi+B]<{*gPPgFbbAeT#FB\jثאԧl sX,{$W h0b󲶠M=hn2C:q1ȬCYQ=yhfbVb8[ijm PhrAı. P qӹ"VTn XbIXZ~[|nh~(UYWHna%!|uLMVp[Z, KOxoM0Ca1+45=*e1Hmh(nUBg_؋{ +]̲*FCfltdJFw끶pX'EjPƌ=12ͨ[&oLdr0W&kFS2%3pulqM>n7b6mB3Ӧ C1 ʽ`UA?`+ӛղbfaϷF;aQ|Q7Tz)v_0֞%s9+N$>06_2 pc ް[,NQ %d ;Szs_[ ~U8^[zLKzipӶ| 8%T‡deb8m7#Now$>`|ĵ=r> sk{ɝhNŋMlfI7Kb_b3uKt_Oq,xr0ەמocW>nxTbfGcq#'S$r[ܪ]{BKf(NUd zc`ZfΠ%ĄQ--ob=zAFw; 310)FiXbYň3iWf528љ+bէ??Y ;8?W=Ъ?ZE11X )2A$Di9(CR5qPJ2u0qJDf-S E 0edT)5QCY1dRΜ6>;(40xT}AiH;j4mg׻5MAP3u>_{_ ڶ!A{8:̀,}?Nu~nΠ 59O:SE2dž2VaF{=`k endstream endobj 1240 0 obj 2989 endobj 1241 0 obj << /Filter /FlateDecode /Length 1240 0 R >> stream Hl9$ EV #qՎYߏDSjB_0)AT7E)UA7jeԍӣ7$ 9ryX/BhuI\/9upv\T 7^g®!v140@w"ϛ9V<5s)[,qoWx[E{;^9F=LjƼ,cJB ukL*{M!ѓ^Qr6YX4 [,XOpV{UW\WE|kݱNV\݊gy[V>U"b\ǃ:=<:6K*SSI:.eI>ٛ?Kqyp}~y§S/XpM&3IL)( 1b0 4\hqI8iNLγAVU:l~Y%9QbWjVOden\RI?l?oO?mVCMn8~}ׯ1_{$,ǿmȲ:hkf H\N!ESp:Ƥ(.O rW.wSFoV"NEI1g7c8*X>=BohU;gwjYmhlvm%\gr%:X$ @\v@I>32KIY ,u'JۅEu5rJYV/h~M$8%8/Se*S cMZ4Rs|Q+:kndX Yv ؘd?̔-eځ}F$B,1ыAԎvf1YUb{ҸS u-9P/pX;(o9ďQP 0TPF(MiZfT}hPpMR}Q,04k YB73^žZ]N.j!@&_͑4Bs-ChFDsce/[M{쾾kֶ訦L&fk"VG@|󨎭W-?jͫZWL6IrbjŃ\.:6ҫBu6!lײ|4EJ2#Nha[($#O~N>5BMyMN)4{je~5'yQEåz CV%PM$lT #vwsj7FN׽j;WG R9 Y-Y'J!Z4s%e+xŔ^iDTA!Dhgz2WH3^yrn T H&N6Ξ"<D^>Hsv5uجx.ŭDU[%}ҌA6\}u7DI@W<_pD$NIVX[)k-wOAghlnc}|_uW;lLrp=?fx> endobj 1244 0 obj << /Type /Font /BaseFont /Helvetica,Bold /Subtype /TrueType /Encoding /WinAnsiEncoding /FontDescriptor 1245 0 R /Widths [ 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 327 278 333 474 556 556 889 722 238 333 333 389 584 278 333 278 278 556 556 556 556 556 556 556 556 556 556 333 333 584 584 584 611 975 722 722 722 722 667 611 778 722 278 556 722 611 833 722 778 667 778 722 667 611 722 667 944 667 667 611 333 278 333 584 556 333 556 611 556 611 556 333 611 611 278 278 556 278 889 611 611 611 611 389 556 333 611 556 778 556 556 500 389 280 389 584 350 556 350 278 556 500 1000 556 556 333 1000 667 333 1000 350 611 350 350 278 278 500 500 350 556 1000 333 1000 556 333 944 350 500 667 278 333 556 556 556 556 280 556 333 737 370 556 584 333 737 333 400 584 333 333 333 611 556 278 333 333 365 556 834 834 834 611 722 722 722 722 722 722 1000 722 667 667 667 667 278 278 278 278 722 722 778 778 778 778 778 584 778 722 722 722 722 667 667 611 556 556 556 556 556 556 889 556 556 556 556 556 278 278 278 278 611 611 611 611 611 611 611 584 611 611 611 611 611 556 611 556 ] /FirstChar 0 /LastChar 255 >> endobj 1245 0 obj << /Type /FontDescriptor /Ascent 962 /CapHeight 718 /Descent -357 /Flags 32 /FontBBox [ -380 -357 1000 962 ] /FontName /Helvetica,Bold /ItalicAngle 0 /StemV 148 /XHeight 531 >> endobj 1246 0 obj << /Subtype /TrueType /FontDescriptor 1243 0 R /LastChar 250 /Widths [ 278 0 0 0 0 889 0 0 333 333 0 584 278 333 278 278 556 556 556 556 556 556 556 556 556 556 278 0 0 0 0 0 0 667 667 722 722 667 611 778 722 278 0 667 556 833 722 778 667 778 722 667 611 722 667 944 667 0 611 278 0 278 0 0 0 556 556 500 556 556 278 556 556 222 222 500 222 833 556 556 556 556 333 500 278 556 500 722 500 500 500 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 333 333 350 556 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 400 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 667 0 0 0 0 0 722 0 667 0 0 0 0 0 0 0 0 0 0 0 778 0 0 0 0 0 0 0 0 0 0 556 556 556 556 0 0 0 500 0 556 556 0 0 278 0 0 0 0 0 556 556 556 0 0 0 0 556 ] /BaseFont /DFGGKI+Helvetica /FirstChar 32 /Encoding /WinAnsiEncoding /Type /Font >> endobj 1247 0 obj << /Filter /FlateDecode /Length 1242 0 R >> stream HdWInm {w9ՑZFYG $l?:&E)?fgD՞XAMϩ%M |bƋ!'d|7_j S&s==B'ۤįm_[Ϭ)-}~)1Ksd?:5uxV,XOiZ 'wxf݇ Y3d#ާ4.Sng|g󒹦 㩡0-D_6؞J&Ӂ'-~f?Go#KݎT^>p,zyK⛟ }4>POWA5UT:e'[ߒv_ҴvT) s 9@1,E^enMۈey#Ķq"(Z?_q+ pkI8\)y.#u >[7R<49󱼆6-ԁMbI/IaA0fBTxÑ.\M6@CxvbMɇ,S&)')n[*i%r=jZ}G F80,Y>_1S=%1/q`Qk2 ,ɾ<.#MvnH#Rl{zďmq2+نn>߲KNZ*1b3wR\_d&F}TBs79QG~4MsmI4>(~ eqB^NӽTzc0zJv^ Q. b>jemowCF5 Ǵ;c/5EWMO֌YJPaWw Mn=ˬqpI7=ȸwmRcQㆿ=\#tWf@rȰhD+0)79yw'헕ձ#]TfCL-ww仍mFMyjĐ ]&_`qZm͙&{].QSLNK.sNgLNq_R츊EFdC63Ťʧ#wa+M}9O, mV aoML\`۱JӨ)zF3m.eW9p\'1L |ǫG/hXg#IJ5H t1Q@F4Iܨ %vN g o pW8r)*bJ\85ٞW扭kHp:$7PnCA'ِ,afoŗ"+>@u[󆫥錞6 A`ܚV^8ܛJ3㬩<_S!gjL‚ &MFɠ{4eu-fw~_=Eb쒱b0bkjgVꖊYKߙU[HCS5X;pkp?9YAF(Bmj~:g!R% !lOkc(E!O>wVD 䦦t܍!Ŵ^N-owtVת% B^&Kwp]d5L܁&ɭo&/6{|J#ǾΔ87,&[4QZ+Oʤ/pܺD j\^58,ۇͅ ኪ/dn][Wr.:vZl9_IrѰ!nqPn&/#ayGwѸ&]툌 Vf=-*qt W Lx,k!iOzo6qWp2f*HݝKGi],=bQb;GXX 2mihc`pog)WȻ]l_gBjS8! q.튣Lً"s'_=y6h,& !4b$d' ,-" KzĝwO<rH[jbtKRsVfWo\6g yՕiK#jx (UY[UF,|.Fre=&IEUJuBTm%'oEEʉ;ħc"4Ҙ5?)?Hv&g "H ZSk:c`ւpԃRs Nqͥԏ)g7obq|J&[Pdʲ AؕFQCYOxbXlӃ1(zu;߃%% Nݜ6YI0dE;}4SU0 hFhaPg+;QCBDب-X;@JZfJiy!Gc+5.Dtn}YLVѪv 'ӇwA>1>=]!8eo+V]i|0|Lun%gQfbCTJa@-%w3 ID>FE'?) = SEaHyG}!tE۴J`rSuE`n endstream endobj 1248 0 obj 2229 endobj 1249 0 obj << /Filter /FlateDecode /Length 1248 0 R >> stream HWMnt }臤uN| ,rT:=00~(*kx4?q!{){x'_l2-`ʭq䱴9c>o?G_]gt{<߸Y]2֎kvF׽k k)O'##{K[_iT/ƾ1~H >0}tXH!v );8m&vawԾcJ?&ƺ=]-Kd(Vz!od#]1Ϸ_6a]?Nǿǯoǿmvm?) uvk4vR o~ ߽ ^ׇ}묁|(`]1睺Uc ]j\;/9znڻW('"+B2v򮖵mg.1 e\Zч)>_XUQC( ֡üAϺ=!֤|Y2/v1QC;0898"a9%&YDWg6&,v&撮ᓶgcO(x4mYSyѫl9$,3GK8]q^z&!;v4l*wq@)muLlm0+IK9pZM + jC}Έ)GI/DEc{a//9A.Vd#`9ʞ[d`cCq|ggUЂ @eNq5MOd.]fL/!q+I!9pUj `Uzf'>3%S\KM#вDq'S+JDro>OH!Q`*f3!s瓎3(ePr/e2F8~J_BO;sR:M[RH֤& %fS9@yĕK<<ڻ[VJ2/4,9Fy7Mb㋢soߴV~sp LRIelߥ=cBVzS٬6}мP52_yEJ~|Ο"f(`@%zˇڃ2ad"' zc)0T>=1uNA]RY_.(֬ʉ5J窦7yDuu%[/hBzخvz%f3NPkGvxQXvwI[O'|n~#pn endstream endobj 1250 0 obj 3049 endobj 1251 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 1252 0 obj << /Type /ExtGState /SA false /OP false /op false /OPM 0 /BG2 /Default /UCR2 /Default /TR2 /Default /HT /Default /CA 1 /ca 1 /SMask /None /AIS false /BM /Normal /TK true >> endobj 1253 0 obj << /Length 21038 /Filter /FlateDecode /Length1 36020 >> stream HkpSϽlcl##< KAe]]# 2zCגnpp$}HiL&vҴ?LW&Pd4iӐ4%iLڙm={Iy]۳}(Pc-ۚW_z k~wG3XY޷ @YZ;FwQl(;s;.fw;14d^D5Ob놰bY~eC#{:7uF,'v8F{P 4b{ =6x< >}ׂZ!;Ԫ:ȫGd/c;7Ui)ޣ}~(ShO#N>={ۻһ}Aig]S`9ӿZZ N;·_PzހgA dpi(">OU ax# ˵k?>VtްUioqm#_Y?N3a;bwݸukZVye$j Xذ/ْŋjR_W[/(/_: EM(f%RXlXPBp^K(){HxB^l4jCe+J}ZMj3mn ) JՌ*+vs LnLqky= +ÙfL^.lUj.:X^¸}Ӛ&p.^jsRÆ[=۬ ^dMr^BP[Y-왹`n!qy}癟uw)w)RRND&8Z#<S3e>+7sqf渦6z1f-3<ڕ1s@Hx+qxM4nG=[yO_?v0yb"*U5o'f̭m3E*hp(1p)mKz2Hr\GP~eуb R5]RY 3)Ew2iԁB&K7=\!~@` ec0M&R1q31ֆEIٶfڹEnBĥ l&~ٛkc#֋'{RЌxzj![8㬍0g 70JrE!r j斯l~$\klP[v0i 8gH/QM. څ366;ݬWԢzT ^f,Om.3&boE_\5qB(wY6 /hbT5GNB d )ygg7Jy{sIbcq1 ģs'އt%aIdF'5- /D x#̄U3ݴ Ҥ$N2ͺ(f9a'#f ,57I'JH{;+`s2ASxm՘)-w#d,1k浞}Ɛ0QKap{~H8Ӈ:05}S 2/.mc`,IYK/cH/nE1Go鬞4)5w]z5Ņv67B?cLLp$I$z (BS ʰ FHc O@ނX k`_6Mm63.T֫ɍnd2v%z[ɞupt@ X[lddAc@4X,aBqX۶5l7hB)_IXLğKl0DEg-VHrrcƙ6Y_!,,ӳ 9 ZZ$ (; du`aJ"2m4v Q9 76kZ^0Z\e5(h6*ه6,PFQ W`T¬Qئ+~{q/qb u#8lPºF( BWЦH ڮfIp`HfCJTj!5{s97 ^aPkgi/ekb)3/yTIj R@RHƺiGe"ڤsԈiқ+@ 97tSsh2D!L6kG F9,}NaKQ?qVpƜ'<Ú;0Q|~<pΐ^J>"Rxk,\4ooQF~//c=]>(Q9CO8}ȥ+\j{GEM@@lWDU/o]wAQ:#k\V,u @0hN}'lDEb.b?}$J:%u٧g%bNE#ͧd>|iGJs*=?~qs>ڽ)OtLׯn Ti紿_5穘{tU3Gt^E:3 2^:jzo!+2nOKOz y2es?]ؚo\C|1?Y".ANp~<'L ܿe:br9W3/Iȣ\yns۵CY$y,N>Ͽd(%t(ʀ/c&/-"5sT;q@PUk4 ƀih6 y>:)>UFrw.հp%#B*J*NVўɼ,^JnƝrbtyشˑr|E x|טĆ@T͸1bwD b~{-ITG.NDMb=TjuTwt+_-r_2xlY*nw8%*pu?Ӛ/[MBw3eZ)%”֑Z4j!*.(,5BI\ !u%55$+[^ҕT(M늜e嚮̹(J%΍s1VVGő9LZqdqU>%2g(1 KvlwxVKeNGrs,٥>}hPsgמ$%*jX͜J|U*IHce+s*CzWNNU z3ɴ dLŐ{ϤԝbҬ2'X1f VJE!FۣFx)ل!$uCb%za)>ΞcIqo feznE: nxJyUyuMu!"oo6t꼵X}&4 qO4śLab}-ˡ~Q-<`q&!,t+| +Xaˏql.af';Ēc =&Ik(\zL 5OAꋳHj> e8@? k{Coʙo2yG*M L? L|e~(á|!*gPd-9˞LhUrfv;dEEdG=ރa1W,_>?'c٢Gx6u]{۱ıuCRLbm@@[v nZ[w($J+ gXVcduI Qcmec+ /;:v 0ܼs9w0 S|\q#ĵDS_q*k_56ߡxsB5:hԵ 70@71ۋ޾NoxE{Y#& l CS<u<mJYs•K#H^+fHQ b+43_ A{,X1{,=X:o.]ܣ2q6a+\aM)7l&v*冉;7e iAFJd"YWm~dFC67~ 21;x<}#OwAO ,@uGtɱ&GlVjA(P$Еܜu< VzN+N ^w#7m*V?33+qtWfRͼ.,xN-n F%#S1p(hˬԀ3цhX:,d\"X3r5ǔ@9%PM@יASFf0 `RnrnEP^&c)fd_-Jɶ1Qn%MM(dN Gb1"Pskqi6ٚ6_ltW6=ԫ}z[_[~Mzjfw=}eO=zN 1(K1{jacLwgϞ&Z;0d@;SWlRL|0QoBBbJ1&BWS)cH_1 q"{6ܴ\9#:eÒ>cqwA'SJѱ*EjPO>٬"\.S{;d J@~(LSJ$EE JP+ N"$$}JuE+0ꖟ"@z?.'vlP:}f"ϾƏh?EgΌK;dy% zq&P Obbc1aZ"X 0@AV<)z(a&kA+*q:W>g]ՊMx .\]~jJ͝N)iT -l.P*BC(ahSQ4V(\4FJ4YP!gLr$^?fH,:6i Vz#>g36Mtm$ ֲ ֺjLW1Eq΃lM [\bVBCkb&5mpYfjX"99^uEʨp$=k8ýg/k7{gkڕ;{zvl>|x#мF˜uL'qK=-/_~y[ou @ࢯN\p1"4F񰜐 'e䑟ZT3Gm| ֩St(P4ޘ7I.h &&;1ɨ1NUySϛIqoN ۶ذ·FO\sx<6hC_]+Q ąuֈVOkז"أa߶PpG`rrY@6e< X4 }&pUs@ja"E*)D@R|5; tgH/IW|gk/U{fg޵כlj-5VDJOb@?!HX-Bj* "m !3c'AY&?BEPPsngf޹w~|vMkLB-ƘgYS  HF-\ɝ(dK5&Ud;-X < I=UgtLt"+ O`92(HBچ+w976w~xN>@ Uț4G>> H CxB I'IB(fA] l{!lFn/Kpd b/p?R3lؕ:y-7Qc0\+[<^2oיϯ}upӎoB+\޳Ϝ~~_z#y;/@S_ Q߸䯡E\BTu5/.nd, V!Ll&k7x *i'qV1TP t+(/zm:^4h*(@c+ g Yi mڂp/܄9!Ʋ\6-k#͂3j4u;\R!e t*PTBJCv 1`%< Wx;xr9pG y73oq7Л^ ^_}' CtVjl\'ն>T[EViTuNN2t=N6xq Ķnd\~6јT$!! zhQ&$~l tݖrm8QcH][,ʆkpA qdOD3x:Ix%t!>[W^ ‡ßSPX[xfѿb(/:E!hhOi."Rg=ݏ}T .rY1uY!<:M3iE>#I&IirָL0[S,b|K9X_^(>T=dRE(h+UnƀL~Ƀ74;~}_ kpY33mNjz55Am4N'z+)EpRZʷ0hCRI!3MVCJ'aI@UYYsJW+UD p>wR5Y'BJ .ؔy|kҪ> paƘPb"5XHebﮚ7䐄 iy$J諞З A7 {,KMC0}4K~aUo .7$!]dҪ,Z f%Lz-^cM'scEʝnRc-cBU ~oSl&z$mfJ8cwwxqx5 DH<~sA#^ǁyJ|>F~yS D5|f@<֖tE^(/L i1# Nz !X1q*I<464 7C]4] MV8r(" ЁQ\>^e6K=kSL`@<$сdJm 4'IdqL$R4Z&IlKfJE&"Daσ->Llo ԵEQAv[x\$ ,tqQqĺLzg42hp>pe뷊lbOyGqLW>D,XȿUˈ~(.L)FW}G) Q]`}p̗u j 7zk#“ ੠1Ǵ6j<đjzBr!JPM)z)x/`/%$N ~ }Y.gXY_zf;g6 `u-|- 0)䠔sl.*)/gi "]@N$!&iڕ'd=)_, 4( >ٞ_K_q2z¼}ϙ,,묜&ٜ})ˉ|`@$n"ը/I??3 Jܗ Tt#ks;<ڱ1T[D.E@'6+`( ;zt}᾽{ýҭwum|kwUZJwRv+im[Ԭ՚y۶Lӊ k#tMD,$pz") X}+?lWl/wϾ|ŎNLlMBP mZ(-VX[u%ZVej'U&(Ӧig'a2UĐV*QMU?]Hk7Uwc|%|4/0v`ݔZ^"ƞW{A]"pjU/`-`:C0!YW= D>ƫ#JsjB jrGVʖsD|4!r&Ы5ãGu,eҒ58jJ

c=-{m䍰h:ZTQÁ|1KjM: wNM5IKW4><k#pPz ġbjP8!qB18 NΆkj9uECq4rl%iA= ɔS2TX òΩ_GMĉWî  V_}E bbXXIrE\פ vitDVjQ9!Ï(U5}+OVu԰]r\EYpFN9AT3u Bڵz,/3zHnu=OVI )Qy. ( fK-!nشb"R|*!ngQ- ZbK£]ё5]O4^M>עM{p]Iq㍏yӏ/hpxl:ŋdIlmEϽ(xNs=/Lʋ6= +&뾴I=tœ!=%Z}eɆ8cI',1ݩKrMTc>еj*pL3]%F/giTmpTm*}5*r}{.׽t7U׻L&P¬Onϸf?챓vuODkmϿO>eM}ء8Қ7]7VTuC-np, NM}hr~xp%[TB)8 !hV D\\>fjX`ѫ]<9V_'H&5+a00BJJA%Jn"YH@$}]o)$5o:D>\@GWq"Jk" Nt`U}S)?2#(NۢPMFpEzG7O N<[_;8x4cPD<;0*Uh5qrPd$.#.BA BѥwA\x63< aC4l:[SC|W7䋧}v1z{r~^?SO|gheΝ?g j%Vk_^WiUG)mpҼ-| з2K@߰l)lZ@Jխ-DGw PuHPi0}Col?H"e~n )ڲMXx,7z@av@!($JKcA EA*$U(~,5@sґNW`U"@Y/<g>4C|~.>? [jkGj -JpC,z46weO{<"h(,6w_y+܋4K堲;?aZ: ShӑБ;^=ԱIp)䭷Ju51/k޻6&ˌ2 j0YYVk~ًXҒӕ̎ZYIrdBhGh^bPM:%&s& ɱ Dr,1]?p.>s33 B?no<~ 7qmNF3Z8 vGvo/}?m jݒ'>%k|.wX įPEiAɖxOh Kv\_2iaeLTSxɤPhA4e˲ U>L'k81H-M衵Pri.gO<%~WnqY 7{d5邪[#["u.ڑ0EQ Jxʭua`PY&ߎ0j%ٖ8XOBɍ|g> >IVEuZPM&j;Tv |~9Hǰ`@rkb}}d}aUWps(䨻*UȿEXr ?ϭ)7dIHF1X#I]N̚f k4.Egfh-Gk=LݼY'{$ܺN6?/%&_}k9ZW086_(^ؘ^ 0'D̋. |&>.瀿Hy9)N7޻- !ѿ.x2ôYeV:6Y{!꜊9ܸ( bc|ȱ:m>>R#8 рeaX!nҢ!3?lKrٌ>c mrMTϕ9tؔ)hl.XR|L&/gzB#d(,$AY-MVȦ +QN9mSq0Ec'l_ N!S-))|pZؔQ˜Ƈݒ{ 0XJ-)X+%=.{%O8!8( L rxGAPX}&C FGĮyzc^ƍ_/"WT|!ܡwg޾5+:]ݢ4v^Z]*K9|`2zqcpIf-]g R'g0Cpjjb @&pCgd9"1N0w Xҵ%d;˦"lr<)o.:Qj,+e>dʲ\K 0bQMU6 x>ːs@ ֪jBOϐcQ*Z2c{3QP^T#Ym20xcX&#x2Ip3Yז% ?{-r{qT  łW8ߺ/8: g9sgtI](uZOo_.z2c+0, ( R#"uɍ(ZBdj%>im|yU+S$OvU~"(욯qZ?UJeh>`d^gL34;XY}l1Ӻ+6&ьn,w%((Wm$h4KW UeF C.&I4 ?3j,ƌjpv8: e+t9= /hm\M祪᥇^;3q 0^Rm z:4FWLdOs ["n_#gycYd{R]exJrʺt:v{C1D'i I =򞐌LLԗ>9=NBNH%LXKvLQmCV*nUIAxmyvۚC;HoC{*5hxVp ˸Wq(^w/f*X1a`*Wbw6ީlOfP%^m)K1{٩3W#BEhM5- *bEAL1 |:sxE0Ad U/5vT'Ӿ.nht躡rmlѵC7k4y|O1Fݒ&Lb\/' yErZ P]#FRgH-k-+.kU:N"@FB+!{1g%Epmg]@SY*WH/ˍ6=;)ؗ3̌Za" c6y#P%VDrIZq7yj9gzY!d 8l >؟uF8ȬDY@'=^#Nġ Q 4_rCM|.'(I.R#i=sI 27'  Nvfqm8G}$wtҎoX['^~4#U4b:gDfcMm}eFݕ71fh ᕦ) AUz2h.G[f6/]WMDa,?6Űmhh jL1TqwB!ODk"tʵ2u.:K)/LQ͵&RT(&2 xQzgڐ<֕tn2~hh4܆Y"%Zc`\JxCV0|+B.D^8䊭:lucE G $=LW/Mk|\6uhh6x0w9zKZ:fmGʞ #xjS}S}շi2'z Kcf$tIȟlxH7|84^yHN9UrR^ '~ tzQ8*y,ȋ,&d\rJ$2K pTuVaϭWC?hQϭUDhtHLI4YݬX+ cFyhyJ&\ÞƦƎkīJxtSKs:uSW ׻J:8kUrbVru8n bp IBOh/:;euAF/PU^<^C FSAFů7uAů!B P:CY-jr3{5JSCBf*=jj(@9XBT!1:A&l)Uc.#gNNl#P'`T*_ ߻|Mm׉Z:n麥tIʗ& 8X×fgǕKs (NBx"0C'`C9r>٠@H!hG #THa=#RIH=hTEUAUt*Ǡ2̾t.V8Fj8UЄUn ȠZ!󳎬l)Uc˷^<~<;21ވ3k={+i9Ƹ~wg~t!@L1& ܂& 7`5snXwH 'țS㕾49wiMO jMz(ȖI ő 0Ps|98K8G8&؃+DE-m#H@--_T[mRԪ&mjG691MV$@LThMDJ-+0;޽7>>o,5,zq3rORRJw[P.%2C 'LF1HrE?PSIZIii-Oٛxbo#p]"es&LrmUȈ%ლ EݲF5Փ+3>}˗7O80>˗rbrwlYgYV_fo_.W_޻kZHxu ;k NvBL֝TwH`sq԰!,#HÅZA{ۼ,y~ZYeۙV]ӊZV:>Q-ժ C&Bu-×rR pv;7;T=~B! Tg$Et%|$d~qjإ6:x m[G.MAWՐDͲ@\S0%nrX|$5fJ$}R 憢_-@lR)c$usz8ˣ6t^6}GQi>;GOU*Q N޵_Zk "n ; IRBiߧPBm= Iu0EA UMa2 L$44耘gF?e}"4IS?Z*2aԥL2O(LP37l<% Ify[qbHqQؒ;R%hԞ#>_ZGx%:$d"{w?!z'&w{VΟ_w 7\hd 'pKdpN 8QT ?"^1S- ! LȲ_(E8>ؐ" QD#BCPfƠ :])J&!&4,5jG|~+JQhW8WYt ҊL$)x42HmSt\.cYKf瘄ϒ=`|Ql,S+KP1b@t@c ҡA( w#+|OԯLLY:qH 3w޻kʀ bsnX\iomV#W,+]/Wfa8) FbaMBX- jƠa31QנQ#AC#FYeF cFU[yK٪\LE1dT-(;P M1%SD 6/`_&&T,*dI}BG#aD13Q|+nSv*ɳA_?r?w_:X?OaEݡr~Ꟃ}tEC@$n#k\0䠈8f'Yґ- ̒T ^Gc%C'8Ҕ/xTn\Prašo&ɽw˒#fw?aLuD%{M]s};,Hab WK\I̹|ܼ^m9HE9G)gZ p(!BaxC͐ 5l==Cmxj_HXݕ[vmVwʝn}vE[׵ReʀpX!W8}a%I`nt"%fҌf|r-0c1dkF1`貭f\!>Eǔx74Xu0Ry"GHKYL$ ZӸ!4QKK&8G#42YҘґ'4и_lzyH#ژCnjc>;IX+@ܥ~̕".2Lp$Y*Uٔ<fë`LA1Hq=C=(Fj(vϔ d1c- *SnP4ù>bX[ kRHOR„lb1+,"Hl _g.W+dQ?+S֝=-/+l9+$,8[6өn[筺Q7sz[RުtުIUm6 bݲti^Ya]â杳"\}`]eȸ#334gt$mPHt?6֏Ō̊/q2A8AL2yyS&N(pL%#Y)Z!%$AҊR)Ոh8lNUV}(ORHNsYsYۤ$d4edY?a+#99r3 #Ɨ[2L ^,T4P/ pX,DAːe*X[gal!YP%撍!_  m Q"3ADʸ]G$1Wʐد C1`dEhC C! ߙO8VA a)2prVbYη'f_.̉Cl} 6 u@0>{z.^s;I8,t 0ɟպ_Wa_(B@X,qlqjo)<|_`a  w.܃?i%3hsqW,lOG>v+o8\_qŔcʎ(y KY0o  :/e ^e%ŧ^eGiIH"^M$2r/P^_k^ogǎؖO[QJW<s]k[W^\nv{{NWeeMuta/x:`FhÅA#!+ԁrn=3Rkvav$1KôusOnދ%[Q}vm=_G]b?Π13NVg^@LjSm+\MOo{~% ~% 5 endstream endobj 1254 0 obj << /ColorSpace 1230 0 R /Coords [ 0 0 1 0 ] /Function 1256 0 R /Extend [ true true ] /ShadingType 2 >> endobj 1255 0 obj << /Length 2575 /Filter /FlateDecode /N 3 /Alternate /DeviceRGB >> stream HyTSwoɞc [5laQIBHADED2mtFOE.c}08׎8GNg9w߽'0 ֠Jb  2y.-;!KZ ^i"L0- @8(r;q7Ly&Qq4j|9 V)gB0iW8#8wթ8_٥ʨQQj@&A)/g>'Kt;\ ӥ$պFZUn(4T%)뫔0C&Zi8bxEB;Pӓ̹A om?W= x-[0}y)7ta>jT7@tܛ`q2ʀ&6ZLĄ?_yxg)˔zçLU*uSkSeO4?׸c. R ߁-25 S>ӣVd`rn~Y&+`;A4 A9=-tl`;~p Gp| [`L`< "A YA+Cb(R,*T2B- ꇆnQt}MA0alSx k&^>0|>_',G!"F$H:R!zFQd?r 9\A&G rQ hE]a4zBgE#H *B=0HIpp0MxJ$D1D, VĭKĻYdE"EI2EBGt4MzNr!YK ?%_&#(0J:EAiQ(()ӔWT6U@P+!~mD eԴ!hӦh/']B/ҏӿ?a0nhF!X8܌kc&5S6lIa2cKMA!E#ƒdV(kel }}Cq9 N')].uJr  wG xR^[oƜchg`>b$*~ :Eb~,m,-ݖ,Y¬*6X[ݱF=3뭷Y~dó ti zf6~`{v.Ng#{}}jc1X6fm;'_9 r:8q:˜O:ϸ8uJqnv=MmR 4 n3ܣkGݯz=[==<=GTB(/S,]6*-W:#7*e^YDY}UjAyT`#D="b{ų+ʯ:!kJ4Gmt}uC%K7YVfFY .=b?SƕƩȺy چ k5%4m7lqlioZlG+Zz͹mzy]?uuw|"űNwW&e֥ﺱ*|j5kyݭǯg^ykEklD_p߶7Dmo꿻1ml{Mś nLl<9O[$h՛BdҞ@iءG&vVǥ8nRĩ7u\ЭD-u`ֲK³8%yhYѹJº;.! zpg_XQKFAǿ=ȼ:ɹ8ʷ6˶5̵5͵6ζ7ϸ9к<Ѿ?DINU\dlvۀ܊ݖޢ)߯6DScs 2F[p(@Xr4Pm8Ww)Km endstream endobj 1256 0 obj << /Length 436 /FunctionType 0 /Filter /FlateDecode /Encode [ 0 255 ] /BitsPerSample 8 /Domain [ 0 1 ] /Size [ 256 ] /Range [ 0 1 0 1 0 1 ] /Decode [ 0 1 0 1 0 1 ] >> stream HT_qru4\\.!WT왭YO|-l_Ro[_g:m.h2dz)u0Z'`L F=;cl;]lu^~FkzF Zk TjJg,*dʘ+0_1-yLerd:`"SL$1=>a4H,NF1d0@(B| z}@˃{yZ}p8q[@-VbCيFh4`BިPk4:TRiJ5**\77 R&]T&\D"KP,BP,@(oG=⯳3ds8ldNu|rrxã&2t=wvvq?J%< endstream endobj 1257 0 obj << /Filter /FlateDecode /Length 1250 0 R >> stream Hd;vt7sWpH''"W`ۖI@_ P(?Ϫ5f}fcty|gxXo1lO3ȣޫ[xONc#2멡:khRLg{P8>ʐo7_(~n3=Q[]wM[(ݟ/qSڞ==HdJce_|=-oSQ{̹߰+ܺ(.N:\H+Y`Frh~.bj0(Zm @Es$?V1-Eyɾ5a=/7N]wg7,L~=e ytqwMŶ Q>c=fퟻn 393tVjs̰G{C?U՞$FS(c5!W6cZ i<ٛ?&E*A[*Dg%-^6Cd,t\IT{<[lœ ܬ cbO%^\ >C9RgS7z\AThi7yB dbo{4 pY ͮduZ+~/l")p䃄$> t#*0"'5b*i$5‰3 f34k,. GbV-˪꫞C#ŦښpfyfX aR*mN6N3C3}-18jy\M>Is%N;])yQ*}'4KFVg,nė=[3 $Vx>vm#izrlu, ǐ>^Nhdj2.O`~pyNF̘S6LE9IA25-{-v%4$8[ܗA4 ƿ`NMbfN&A=2jOV{bR6fCёRBы8%uLJGP !<*[1ǧ앉+2 ;q r5SYX$n[B&Z7 [gmWT5|8o- y2d] `;kq/:n?1rjh9.5W?uz'L翶*/X$qN nH''0_Hwҋx|xSTbfҲ$OE!u?QQ+P5d{ԛ5y\fowEr" V%ެ|;A~`Ayz{Nܩ{bCm ^|Ͽ4??T^U=^- 0ί1H"Piڴ"VL<_QF7y}?8I3 ; d72JGj (NKO=usմ0x}'{L6QU$E+Y`NH.Eq.)GB% WnZT)%vb#\ܵE1Gz.)av(A7]n5ң! ҙspK D*{P/FʄqF3mBZdnڿLML\*_HWoc&[XU4}_((yj6*oȿW鲯lȒ9.iIk쁃{lMG2ף}W1]ۡ|drhMʩA(0jlw endstream endobj 1258 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 1259 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 1260 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 1261 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 1262 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 1263 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 1264 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 1265 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 1266 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 1267 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 1268 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 1269 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 1270 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 1271 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 1272 0 obj << /Length 239 /FunctionType 0 /Filter /FlateDecode /Encode [ 0 255 ] /BitsPerSample 8 /Domain [ 0 1 ] /Size [ 256 ] /Range [ 0 1 0 1 0 1 ] /Decode [ 0 1 0 1 0 1 ] >> stream HQgRS){J/MD[,YF3g8#)9L$Yrj1G @ : Ggx"yHg˫uxS-+x'IjM^oSjw{~yt}0Ǔϩa|fr^oeYͶ UCPHt"F3Qx#! IKrRt%-u Lc2S&9 O{ 0|l endstream endobj 1273 0 obj << /ColorSpace 1230 0 R /Coords [ 0 0 1 0 ] /Function 1272 0 R /Extend [ true true ] /ShadingType 2 >> endobj 1 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1193 0 R /Contents 2 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS15 1231 0 R /CS14 1231 0 R /CS13 1231 0 R /CS12 1231 0 R /CS11 1231 0 R /CS10 1231 0 R /CS9 1231 0 R /CS8 1231 0 R /CS7 1231 0 R /CS6 1231 0 R /CS5 1231 0 R /CS4 1231 0 R /CS3 1231 0 R /CS2 1231 0 R /CS1 1231 0 R /CS0 1231 0 R >> /ExtGState << /GS60 1251 0 R /GS61 4 0 R /GS62 1252 0 R /GS63 5 0 R >> /Font << /TT30 400 0 R /TT31 459 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 2 0 obj << /Filter /FlateDecode /Length 3 0 R >> stream HWn}W#м_j Y۰'Uzɖ!9EYSnM4pŪSUNE&Zܼrn8^b;00G|&Q֕H,<$yq8}abm8a(n@((=JV\u&* bsc_SέNC/pDmǓǏq։g#a9Ļ "L z&2OVjt?,Xj,,KcTg9NGhr&:oy:-Qv\^+JXYjd%.0J^d%.6ײz< lfASCNh'xH}C?knQݏ9hJ94$vY@h w=%@[ն@[]8r]MrbC:gh"(q]T,o娙 *&Il &S[xSl}}[1(G︥yK>;&r=:~Ʈqf @*^MP(7R;|YPaOXޑ0 ˠ!>`Ѩ)@OU!srN[^ȕx}<2"ivpSDREܽ5VfY^6/䜀)!ifpia^ [cun@_MnBRëZNYG'եάɈ~9q6R.<[zI?s ܁ΕGK~7Lpe!eK~߈%L۲G]b/xDӆibQtӇ◻ñ$X tf8>zevYlk'ժ[+jӬZ5įq|ɓ(_m״ ya[دwjSSPa2Ԏ/>|VNsh3Ox.M]/t}扼Nurw fdTEٮ$yQ!TzޯX뮙搥C?pq^D +ꧡB{7JSqX(A#=Tԥh#eiIm#$Tr,M%Q Ѫg0Ht\nUx4k<$&me/q5==>z(8N<,} 9Sʩ!#/BpR7o ҄yeb.Vrvw6/r|f4~Yr}Y0)atkfиKu, SUha-EN߈ͮCBӌ*:?qCtgYy-I*\=m ".l,OD g^SᅦCb-wgI˩xsk%l"vJژKDJyk&$"l_!VUWT"Ιh3`z*hzjfwEpq4ԋ#kMgWh-zؐa?+K U bmؤݴ.ؾ i͙j*P,veYY NJ5yx"sv %VIj'f+eܲROgh:3[zS⛤6=pfDYc\֜Tenq4 HōBqlzA(߅WA裄NԀ`+G wZjV3+dX:ju] Mme`H x2MU*la؅ ya°5S Ub`hm/li.8Rސn-LzF5+֖jߌkοjۍG aEZi&iOO`cgmg"LcT)Qlb7)XS("o?FD3^Wg#.iPBڐ vL.!̈́Ts@;bBK &~h[d(e$CD$H޲("e?=%D4ݲ{hDavQ,w2@Mע5>Kћ|\|oס\y1CӸa`0ŕW4_ m ,>"j064iT%a玌7rxE6[v c[l'<58 @ڌ8|(\zξE^͋GD.}Yk?d)\_9a@v'xq)Qu 0={mϵ'yAO3\޷jP1b닿f7ٗQO?n'W7;|R\^]978y/=_#;AZ ;V3%0L~ǒNiyoJ"]1۬EtPme<MeoB`eŎ '%]Zs%qh굖!}g0G W8/tnBQj&,u$Ūb{w/h ʭa`YA4ٸA"r˄vm|F c ODKdK{42,䙡%vB_vF+>dW3''S:KGyob;uv-t4zod"8J~5 g8\Mr?e׳׫Eo|NT6oؗ]Vy=|H^K_Jd: E$!J7Qn N,BUhv]1;2Qs7~J٧(O? K_$V=TMM8U.{Y|xIϴ3_X,30$"ہb8F` t9%ybFy[% qB3Bw֌E.}gDNx!>4 7" I4=pm^A\;  D$  py{i^ Һr4XIWI DGȇ^ бΣI0&ߎ?EX%ʕ|)J"X~@`N6[vte!'d:KDewTJly>)i9,DɾL-'*VD8Aqa6xQ)}r׹%b*ewIt@ ![ Ӳ:BH?ן= \ΗxW]4%CS)vST6uom*Y}?+Li.3eQ:@ N||2;++,5zZQ]X`ik 9/mA#ltяjGBbK+[ek #ĻMuS(ו.\9?MvXCE;|KvH.Y52UzϾ Wa+(X4'zZ87< U ~5&V# :a]`]bf%gO_K&R_EHxȫדR#|R|E!VZvZ)Jivp_QZnpD'iJ֕X u%icQMk$mc@ZSc- G,\]#Zd8>QiYF\3VZ^U3:Qapc deMxbR-J!Đz$b;!CL^תOJ S# "42ZHӂM ]P:9*j-kwіOhrCW_Z,k]ZRg kF=?h#-=#TرޠJk+^VZ!+v\*eCn(?wYZNBvt/|Ŏ?ՒdI}^Ϣ}E$^g;1`!k SyAy뛙{4uP+<|H 𼑊!bTfŴ+F%o+V@AkX>4^#c,X@T{*zFj\=ckx7cB1u56*wE\峰1k;t0  8q~|b|g:ەnny-9uoX_'wzqOjgX$<37d@ hcxRe),T,QUϺL NݥW:IĒ¨ qqͲ$p9Q 7DbJ,"`5ohAPpJJM\7.ˊ &'93PY%ǓT$I.~=òM L6.O #ϵqw}=!w-N2Ȝ}HqCxqKG4rj 4nLΎ F QZ01RM7;JZqnC~hQC$'aIb[z-gC}4{O<WvZVRu,gvXVpěٯCu>֮IJrz6, +vx5@;8eV8:XUH]A^ '֎šNo*ܕZ`8ӻU&HEK[E+&}4[&JYͪ0,PgK]X] RaC_Qeeg=eKl/Ks9hRcAܨZTF ҩ#& $>F/ xt*["؁[U%ފE׈_f4ipU]]d(zCD~~ci-ȩ`e"RX5] l"8z\B 9CA5%K9gGZJ55՚;S/~5-ѧ' 1ZbuޚLTL.eIآvU>4~^GhhZ2A 2BS-MptQ#y ŗWozbR$]̡4!҆86e-hxmk <8j I ǫO3ɱlKK; lW6ea]d-9H:V*VHX/damm u>:MoZQyo~fCci=,V3;'#`Lƴ}Xі#.6#.Do`qD42/Z|!P'wp~XgGڱFYթęC;>--)CaPCfwbrb GWyb5$lwx"F cu}c%NEFj"a8Nh!psq@̝ckU݂ZNFQ63I<-o%}QTAnNz #q*Uz(brÂ7Np9Tǩũ7]K`OwDm|bۛ"a#7⒑x |+I> igF)S[;зx/vXv=z2_8#G+:gk \u +_F5,@3r ؤ⧱Gyܲ\D+ʕOqX\ZQgzNp|b_Bd* O:FϰXrdA .a R|@C n<ށ-v)+Jmz{th7lЯEEIuws}/'4^-$)B- al SXXOWSDb)hlTVc@8]J(t׼  Ϟ7?ڴ?-aXbh#A+v[>[K|p olAXⵕr!e_Q"s0,-1,W66栽?7`zD%uYi;6f{΢;<ڡ3iynt>GX|f?r:OK|ϗ([d^hkee|8âMRuZM5g"z}Y>1* &7S[k`tgex f50l;íEMبIݜ uaŒ_:v'gJaX*NJKX[@:v5Fce L27VVZaQ 1#hҳR\ldUOFenVgAf Mɶv@g1OSD"i%3P3 O$#vGjdW>K o^о0 =tCqCɸd kH j5hPLlk:2p2]~?74ƳdW̅8]KOfxw'3ke='i]r2 pXI<@tzp`'2pF'%И 'Ԋs贠`tX}f !*']@<ٺ /I'SܱZuT'WuOc & S,/F4´fvsT7m0ot6}lC{e|8ߘYQxHa:"W_C|aԙ-g /S\IcƲh{!2챼173Ea?~sh7R0E|2~{WLNwBezqGpd8%_j'4JwԬԌwji!L{VKfk%V{VK`h^UK\`-ekθb^%`Y-ĘٕԒ1I-ah2SK0b '+, pĤͫ6orIF endstream endobj 3 0 obj 9047 endobj 4 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 5 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 6 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1193 0 R /Contents 7 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS0 1231 0 R /CS1 1230 0 R /Cs6 1230 0 R >> /ExtGState << /GS0 1251 0 R /GS1 9 0 R /GS2 1252 0 R /GS3 10 0 R >> /Font << /TT0 400 0 R /TT1 459 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 7 0 obj << /Filter /FlateDecode /Length 8 0 R >> stream HWrܸ}#'H7EM9^lDcHbIJ@/OwE)vtMeڲ}[-wSQJǩOB׋EY,Z苼yg)I"D7;{/G A t$%i$ _Пݝyl;ؒEyn_nI=7_m }"xhà yX8dQ(Pt>Z7g*Oqt?Ioex'V1^CGy/̱R٧8t X "a䉇b4;T5ɋ323w$5p4P}~u{"Ngn|N?N7W\nj-=+ce;;ą!<#7qi2ypJ196 ( C7XɮIFsMǫ/)q8s ݫ), ӡ09J|j 89?_GGxw_ Z5#I(㥇w!~q#ʦ(s% "ZSЇjnn ξS1 cZQ؁Si]_$Mܴeܩ`+]2\y]%$JaA:xd#!6gq/p*]vlڿb^4|ݹ8,f͞BY}Om-^7H;8SC o3͈Cel $BM0%ZgJvX4X}JQGE!97 epj{I[Ybic.|_k2?8 o@1ԕ5j@ޡzT {"Ω}ݹ s"ji6B+i`$0-%O8K8ѧ=ZEBlaWfwH2FWT$(V/!. y40Zm@19A]9RN׽<돈!ZJ`OvEWb2}HZ #<oUsէw*;Zɴg\Uf#Nd oles7߈eS[[ȨZF{qΕi[G&6s1hiv}V'6xmĘ#Z7^^!v//\efrۥʦL|[-Ži\0r@Y/RjhZb$M;j4wwyab4uw?sABpm(Q[)oK/O?Od[)`Mh@X@vYX~ eݽL^q8r4")QۭjvZݩ\g6[Nⵓ}(dat6e"HGE)J((nbL{x+ɛʻ֗{*o;{e #C=QfOz"5Mʩb<>?OLRgut6fwksn,g§EIsVA^`ɭ9< =?Ss,,WMoHK^>Yi<7y_Os]Ob UeIY~e~GZ8i|~Vըģ[ _4(1}&ݐ{zpO-0 w< ݩ=Yݡ=0!ǺmCA'NQ/[jOE"9`ס)ű=:ni3  k.hMe%O5E 9ХsS: d,NVD d? x$>]xk"℆Y45mV$?YN5X5ՅN|vu Ԍ[ۀU-7iׯ)ugԮbKvi+8Rxf9׮#( (u=k2 >u.LCv1ҪT!~AZ͙êIirQE9E9kJIDT[49z9Zjc94O^[]M'J9ԢY&>J{uWKEKΛCTUR]dJĉX 23HG%jPvBcPwx #R.ǻptIq:Ã^PF9]B[A4PɑW51:d2a&8i'Hgj@KYjm\Q1Y5ԕxɝ /U!m|PK!.M-D$hǙAPbB6ݡ 'uZ+!~@ d}5J:xff$51f r>oUݦ^-=V*)8E:qV3d{lG|g50o"TQ[+D2e#ƺkPЦK+"[z5.÷=MDĢCQ!QxE`!X1Id&46 Z lszt? endstream endobj 8 0 obj 4964 endobj 9 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 10 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 11 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1193 0 R /Contents 13 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources 12 0 R /Type /Page >> endobj 12 0 obj << /Font << /TT2 459 0 R /TT4 1246 0 R /TT6 400 0 R >> /ProcSet [ /PDF /Text ] /ExtGState << /GS1 1251 0 R >> >> endobj 13 0 obj << /Length 3965 /Filter /FlateDecode >> stream HWKϯS@o=!H% #fhD-Iy7?؃r=rZ䞪C{(6ɪdݫ4ݝ|6\0uG=D OluCXVW(EĦԜr>|pv2XkCqB@RրŖccM^mzѯc۝5y-;j{9I "Yh<aznJ*&9&tQ^ !=pbe Rx<'IŅRC7 2\(qhwtk2Z7.)p/T͍jDb5%|-Qi--bEWH6+yvfM  R4\OR%4,0ö Ƶ\5+ۀ-0 l2xFEr7IܙW t$ oTCiNi:~csc%GpG|dmSZ ND DEI_9V*gERuQ9Z8p.ş&Eb/ ec& QڂH{ _eq:^\9y=3 {;zΑLH5,ۓse 3]hzǍN8@2 [-L9JˋTb8Q1^׎6kcQLSדʴ8#I2|aۂ7}2`D)?=I|c"eoCU)@' `;PY7DڵN $I* 8Ua+(RT8%4T߾TVvSVLG v '#Fخ@>H)PAvcUB _el[U7wѪjXY˷8 Eu5Z^_w31iHldk5q(ZO9w\8eli8RS(TFW *I9 - ky 푨)H*" C‰FS!BA{qV:Trk1똲t pSV> sF-7;Ҳ60ED3$w ɫh(nטlIjy%rXPp)삪Af#ӛsU}6psq;(ijwm٬dȶFU87DzN?%+!~S!%dh-KS/'wwFn}Nh8V58 bYq"H.4HYYy*JWի.k޹y2[믉GWCq䎨Y䃳Q~Q9<L<.:k"Q~A&Ԍ@[u/c受=BdIW|`Ȋ@a&跊bTY$EP(U;B6޻XR9Oqؖ6wOa+x /{i_}| \'ztFUܘ<çS8980JCBHE,NY-%[;.3D\qEQ!B"LsEQ^IAQ[l1;>QIyvB5we6 b;mL$euSD). } |3͕hqF;E}m+[*.Mm66Xqkk,o["j : n㌛PV?&0H'*."_;gKZDz֔לuY5f)d2柋N 7\tK\9KnWb,xxWDg>БKj!ضJ ٤8Anʉtzsn?dVLyfkaE6gHYM JT-1:uOxB0`(X#[LhN?1iP:{ h،\Fv*>sZnYN$h,SbHAR]xnJl(/n<> /ExtGState << /GS30 1251 0 R /GS31 17 0 R >> /Font << /TT15 459 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 15 0 obj << /Filter /FlateDecode /Length 16 0 R >> stream H|Wv}WUS$@=w%q힗>β ==rtIHf=O8:}Z4ǦOU%k?a3_0)SKƓ$ IVbrVv,@YJx0֕牐`" LRBY doāSd)9nMM>v<v,glW2zw2#8b\RLwv͖vi}Τ΄s3|K[m%Zoizv6Nzxf0{[[[-ܚɧvՖ-hm&Qmr\~S/={)pgllYhLdd n#l[׶|`sE[MgWAY@"`afL eٮ79 PDf? aP=UW߰}Ow]*a.m?gǺΏal_1Քт]k`+'iA8W~jucsY2 u0` :꪿a ìW;}} I(&5P|"7ȯ ݜrK)%fl1i)=/1QϘb+e[lHrzuJC9Hk3TQ#@0= CTo5U)![3tfoEH>;r῕(!sv/JO5+TΪjT(3!QRv/Db]UYQO+#yhBtZ(gI1g-ɿO^k:$ NԺ"Y=J axR@^#U=b0~dSjVY~١iUY*?7ԍN]p0С-碢BELiU;Gz-ű/4wm*D1GZ;2k}^H9 bHJ#=6=ZI~ql7 @Ey"8E!Bފ"S۬~xsL"Fn< ؾ nTHW*.f֛DtVf{(MEK#} fK7Z,y._6bV sI Vwj|U.^9m͝A]G^H^ON" nSmȥmןZ9S ~Qϴ_ܝjb(/Jf%J3O0|iZ5vմ80%ٚ;\g75'na:a`fQ@83njR‘(ԩa04najD  endstream endobj 16 0 obj 2584 endobj 17 0 obj << /Type /ExtGState /SA false /OP false /op false /OPM 0 /BG2 /Default /UCR2 /Default /TR2 /Default /HT /Default /CA 1 /ca 1 /SMask /None /AIS false /BM /Normal /TK true >> endobj 18 0 obj << /CropBox [ 51 98 561 694 ] /Annots [ 19 0 R 20 0 R 21 0 R 22 0 R 23 0 R 24 0 R 25 0 R 26 0 R 27 0 R 28 0 R 29 0 R 30 0 R 31 0 R 32 0 R 33 0 R 34 0 R 35 0 R 36 0 R 37 0 R 38 0 R 39 0 R 40 0 R 41 0 R 42 0 R 43 0 R 44 0 R 45 0 R ] /Parent 1193 0 R /Contents 46 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS0 1231 0 R >> /ExtGState << /GS0 1251 0 R /GS1 1252 0 R >> /Font << /T1_0 461 0 R /TT0 459 0 R /TT1 400 0 R /TT2 1246 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 19 0 obj << /Rect [ 109.08 155.03999 119.03999 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G4.389948) /Type /Annot >> endobj 20 0 obj << /Rect [ 120.36 155.03999 129.72 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G4.389969) /Type /Annot >> endobj 21 0 obj << /Rect [ 130.86 155.03999 140.22 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G4.389996) /Type /Annot >> endobj 22 0 obj << /Rect [ 141.06 155.03999 151.08 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G5.973661) /Type /Annot >> endobj 23 0 obj << /Rect [ 152.34 155.03999 161.7 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G5.973669) /Type /Annot >> endobj 24 0 obj << /Rect [ 162.84 155.03999 172.2 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G5.973698) /Type /Annot >> endobj 25 0 obj << /Rect [ 173.34 155.03999 182.7 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G5.973722) /Type /Annot >> endobj 26 0 obj << /Rect [ 183.84 155.03999 193.2 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G5.973730) /Type /Annot >> endobj 27 0 obj << /Rect [ 194.34 155.03999 214.25999 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G5.973792) /Type /Annot >> endobj 28 0 obj << /Rect [ 215.34 155.03999 224.75999 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G5.973816) /Type /Annot >> endobj 29 0 obj << /Rect [ 225.53999 155.03999 235.56 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816051) /Type /Annot >> endobj 30 0 obj << /Rect [ 236.58 155.03999 246.53999 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816145) /Type /Annot >> endobj 31 0 obj << /Rect [ 247.56 155.03999 268.56 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816154) /Type /Annot >> endobj 32 0 obj << /Rect [ 269.58 155.03999 290.58 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816224) /Type /Annot >> endobj 33 0 obj << /Rect [ 291.84 155.03999 301.25999 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.1079800) /Type /Annot >> endobj 34 0 obj << /Rect [ 302.34 155.03999 311.75999 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816257) /Type /Annot >> endobj 35 0 obj << /Rect [ 312.53999 155.03999 322.56 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816266) /Type /Annot >> endobj 36 0 obj << /Rect [ 323.88 155.03999 333.24001 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816270) /Type /Annot >> endobj 37 0 obj << /Rect [ 334.38 155.03999 343.74001 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816287) /Type /Annot >> endobj 38 0 obj << /Rect [ 344.58 155.03999 354.53999 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816302) /Type /Annot >> endobj 39 0 obj << /Rect [ 355.86 155.03999 365.22 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816327) /Type /Annot >> endobj 40 0 obj << /Rect [ 366.36 155.03999 386.22 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816401) /Type /Annot >> endobj 41 0 obj << /Rect [ 387.36 155.03999 396.72 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816482) /Type /Annot >> endobj 42 0 obj << /Rect [ 397.56 155.03999 407.58 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816493) /Type /Annot >> endobj 43 0 obj << /Rect [ 408.60001 155.03999 418.56 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816636) /Type /Annot >> endobj 44 0 obj << /Rect [ 419.88 155.03999 429.24001 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816640) /Type /Annot >> endobj 45 0 obj << /Rect [ 430.38 176.28 439.74001 374.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816672) /Type /Annot >> endobj 46 0 obj << /Filter /FlateDecode /Length 47 0 R >> stream HWn6}W*`H沛b(w_6E،–IN %Jd/i&)f̙glnxզmbbuB1weaf؜Z$dB0b;U/աQa}& #IXOHhX6KE(X%t*9)|év}/{GhB5e`x%oSWݍW C`Kq.LENĂ^".0]R bJRfbBI!kcSb9iTsvOZV尴2Tdy|Թ# $F)D < @ eãhi-ܭ4h\o:#OX ެ"\m 8qu[m`r{_m^0\Yvm׻:/q XWJE{Or5ƈ1 L3{PͲGjv-̑. qM-n%U9c5D)/ y$s#y$Rw(k<@+/ꡀp%YPt>r1%eiA&aӽ3`#A!QÿC/mxnyYbj%jrX ֹ.m{_[F NvV ?nz&<@]M3Eue 3FRH$$S*RqXtx!aӊ.P`vA¼](/y sS̓!]r $'}uq`,|/հmF.>`"ӑvH+o+lOnrt0X97"Voo.߿& ߑ;_UZSQ)KO66H9XO"g iUޜx e ta31Mq) zJ"D|Oش%ms%ihZ&h:<][G80r4G4x=zFa"Љ684Pg8!k%"O ɘRȢ&qWh?!{^!/nٙm6tRDfpoj=7P7HMXB:Rpn(dg Jc%RQâ)0Q9s>|Ys`ug^Cnuez>oظ,I֝/@җL&Vf] =`W}GbDEbsQѶR>e.a-K#Q_u&|W"^jس(1)5{Րӡ=)Y0W$~uFr'[ \Q|ڊҲ$ d视Cu kHoĿ1WT0q_;(NWޚ*۫I QmύDcG=N>H,O<.KUd )$'|-mښ=q;ЃEf3e?X?Y+ endstream endobj 47 0 obj 1686 endobj 48 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1193 0 R /Contents 50 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources 49 0 R /Type /Page >> endobj 49 0 obj << /ColorSpace << /Cs6 1230 0 R >> /Font << /TT2 459 0 R /TT4 1246 0 R /TT6 400 0 R /TT8 403 0 R >> /ProcSet [ /PDF /Text ] /ExtGState << /GS1 1251 0 R /GS2 457 0 R >> >> endobj 50 0 obj << /Length 39368 /Filter /FlateDecode >> stream H|WKW\hG[ vdAp74䊜9B| rWUMgz|U1SwZ=Α7y*43EZjj)LUi͔w&5ʭNm{oϻ(oџ#\OLut,W6'|9WͬgYE ɳTZeL%))-Z?dյpu%l D*E+E2K]^~Iix[ީHg>uKv&-MtfR>Gԯ:s_T^(BgyKtdZ Gԗ1,,%;n8N_#% ǵ. M_? z'Uߞ"q7uSEHk=𫡝Ծ/Gڥ%Qi ]&e=R]_?ORwj,שKvrNEhn"CS $V y<$[&yדes9Ȫעt8ɃHÑ߆+gDFd;ԤF977iSS5o|j,{ V]8\|LJe-xܪf ܞfd'gqVʛ.?AyPDV"{ْpճ"捤|639 };:G͞Tz<ӾݍԠWi 8#:Jt(ě=tu@9*7<Һ㿨ܤ?]WeB|7:ץ*Z@A h8hSR73(|Zg!#g ~n*yJ- {ԩgBe@+z{jylA^ , #}=m?#!*-%qs$4UӱޏSp9M znȌ9S!X=$c^BU]5%rIOĔ}=vǚ׫#=Ih4iV!-^<ze(& F=l@1[D!m=e6`%I.D4پ[bx$F5.6.)Ѐ:yPSMU.Y21IFJ7}B+9wK65O[(]$/󘀏Z*tsJL1?KL#w"@!JvJZNևZQʢGAda7APWo'>sNb𮯻JGFBq⑚u&+,yzjA;n<xZӄW\K{1 5W/NCWAf^틵y|Fg"# ևsMsF==uQ-c+԰Wm(` ٫Cz(oOoGTS tu 꾻Bz0뺝@7ɮpF9"(JɄV(3;2ɮ.u!CzRf F_XY|6 Q\(R+jZ˵o>eL.X5>"~GZuLxҟ/W<_M H+;>oBAM+*Budx3ݱ]Ӫn{nYdpEۈ8 W$T7`q@BXo\I-[`!<-Wj6hn"S@'7q4VG 4Nؑ;<ߞDIAbʱTVctiGY/8|S6~f{d6PSF-3pXīz]g~5" F"{rUAJTB1d.v xDa\S RLKM0ۢ9P_7M` Uƀ+ei+Sݕۗs^,kߵ1w/~~ShkrGLoz#0T)PeȖ"c9DPXXt\r7fT-;"D뎩1Z]tܺv9Dw<ei/ILjoF^xeK a,(er Y?s3+M>K2)l-A`9>rODr*SZHBB\$36vOyXw Be:+,r.;rCI.@UnJ"s`p\rmGSG\ɖ!CF-JCZtxD1qErmBa:d㩼R%Iw*BLdN&C0jiMk3]ajXE!(лh_vD Mk#zC\*d#x$hJ$YWi;%Θ 8pO1i!ƴ.J;`E'DGӣ* x*$ڡ* AL:P1dvJT{Č&Q`3>~I-ٱNai#&bTWݻ=@,!D.], AOǩ KDM뻐=Af p xZWcoaǎyؑ>FMoZ,LϿa0 IXZ>4ܞ&W?2 8ֽ˜=5#OHrE^HGiǫE`f%E zۤfVm~Un&b?߿[`@ENڣ1:Iū۞ycA[6-Ԇ%Ԍ?'5-mV?D zާ=Ci1~2a߈Sg \ H锡Yky2V-Q~Rf>e܌U;x^?a+ +->&Em:ɢW7?ldk(y"je8[Eɸs#\={Lia>ZH=r1xVpg^?~y!3<-\!, w(w?Q"8*5F[dzaʃ ҅ Q)Mz:q"*AT5g_3#KfBr4ELMfFwg` PΝ-:gxP熺RTj&IQ"jݛH&=%tv'߬@|_m*sE=dz1Y+r i#*--,9$xnEcr@&Ҷ,vъ].9_\JIt^4 ٵ<*s'{b0\aP/+Prۓr~u3{:_`W"a荒e)KXcEȩNUec. .TI)VC1j)T|ΣbP~ţ0vU`(ć{8Kʡ|KGg}sUSHS2MxyŻY~o+zZ]8%8qA(zH!dpR_JOs,7\z8VؔK a%.Uoy!MD a t9\ dp(ù=d9?A϶ve!LI̷|y؜b5|,=.U E[yЦN7v/}6UN|,v.R1  ?<2\ܞVNx\HF`i-gD9r6:L1\BAi0wy8&"5=Nz@ޙpV%.R d_dV濕Q,.EъYR3+ YSd{;8#8pu5LLblWuoGLiWV" j]N==e-d{ dǢEy\ÐM ]Md}KRz8}xy ʷ>%ǧ; &Mn]盶+2;go"+Hs2O-Edq*p Gވ8DS@·|txKd|x֕웺> ;l>LcLYCFO1n8aM(џ5z21rSi<՗CEfgZ63fvQZi1UPh G yJ}Ƞh[a53Ku?}$- [?7NN,*]R#q_;}:/z~*B+DH(cbG㑤_Lk(2r~x8?`eOd9l~}S2Z>0 |v>G9> @ȳrGpKI H.t*\M^Pt%Dw|^}g!B5!2~n_J:R.בL[ɟ('_58mM'q,/rƟw`rY]cM dŪ{",>0Lv~83uB;v+[<jĹܑB%Jg}!ɘZ ]dY٘o\( (V/A,myť[mIE.b.(E#b -3bJM2Ox~Mg ŨIovS }HX !X4m#6iŵId;Uou:dyӘqȪyIMz0HP Hf"_`e{g<2-tߊwf15(wyFgv6JB1\4SurDOAmHc@"Աx(z`CrL;j|>䁶GGD< njFo"\4lTn2VC^|y%}UѮUK厇*nz5+h°gBrBVne8To?dsr=P]eW7(ijh6lHˊcl^`" *L9[щȢo [eD20^9ÿ2 _E75Hdabz]J D]tj UHbv7&aa.$h廇*-Ϗ|^ϪWve ꫱k3E%cٲ5q`XvϪeN2}otV^E󛫢Xؐ `XTglxytF5 29486s id7_ŸG{J;DΓ"7Zn("FK\MY}+KWF+Ѳٙtte"KQNk:n 8XTa(ߢ^GYB6b,ҼbL2w-o}~D=U)^;οa=H&FVO@7Q1F0߲;t@yUNͭIuƃLڈ%mtkͱ4NLHޑkL`hn79NFh SJ:y/R 2.ýf1P_%j*7P YSȉ ˲07BI @GRU/01tjݫ… ljЯ g/? ՕW > s_AVrB" K{Bv=PCLjtH0Xhh彶3b >yMIzu`|f)I])rS\ }Q 'x;SSaRœۀtd_VHBlv,٤ԩHS=XEB 1Fu_c1զa|CCRDMhVimi'?&-%$d ͑(mJN bnD5b9-BDžȡp8ռ[K3h)T|vXC7N䌶VA:ks!q:$hulD7+lYjF}|x|UVO };W13WC ZOg]}< m )s[T6l~;9ʉ^.P&ͫ\~㘕J.<*TnTHܪIo̰2VcÓt ϩ'`O9o(',^ JNJ忉ed v{֏]H/k"y;=C̅ǖWCQ֑} թޚ;W\Ѣ_SC̎sI$ފ43$ gjxʕ$?M F[%g1L0~|bСXH1A+*2dLC>g4"cQVi\߅jBgĦK@0t(DZzXny`I1M.Ay$EuՑ3O`v3~^yЂ+UX_6E88'N ^X814M$^{op$1&G{K"a%!cC `p%D DQU5%BCs8M!}31!b"H{w#%1m$TaJ\^[݈Pt,rƓmcb ΀=\ϊC!. əm:'.\v RN RԸG>'y'>vSnV݋ b9Np&F;|A+976aҨ$/ZT]7ukG7ǚE,Bƨjr>Zdˈlp"QGЄsOMر!ߤ`dIOy79WQB6A|{k2\z"q/ƴJ.W23hS掃^ 9$ze2rÙ>tdM.ݿGa\<#aZ[uV$J#:Ӯz@}ӝYHĶTXi+ye曡R~<`M*ĹYF!,"g/=y/lz]Re Y[ Ϻv"\bw"nOcGݝg$r *!X%KB"PK/-U4}|2x~r+~P@@By$tp1 iᅌ}a?]!N#żE ^W0 ƴm/|[IR%)8Kt;)]œ.@04\Xۮݷs4p`#ZžXs ~*% 䃢괈:%F]CW2xeBf'v H7.јP>4S함L]E`: O]i3dYz{pk[% yĹ*ep@ʅSa7^aSAY"ʩ'!V .7]b\vu%Ӡ}曢_(RzNQt0v YGѭa VSuCC!ﺓ݈9WP'u3WwNSA!KY*!17(SLY8lɢC^&8gG|ĮNMѯ=I˜Y]hr߃dO$tC97ں s3$ 17EV]zB[Y>'K=i~v [_Fn|lD|T9x0٦v% #~ֱdQf6%t(CJ2X41N鉬:ߜ 7FUMHf|Of679~B*C.n/ [X{[t_ß- S&E*_8#tbHCVoʮH"|`ExG|e&囕?Yy(%/-+TcVy Pr;a)[wQ~$+(b-j9g/k|l0? C,yACF];^cB6IR+?Og~ng%G+ /uy7)"z{𝷺t\i?98GP]M",|ciwSHT- Y8 .H~wސO&ԐĎzqh9!-5uޡJ_BQ"GH_QH%Jsw5wv"UξUh*g*6e1ZBš1D7/Ș1&*WPK@ƧC2L͂΁W=,,̞]#-w64 CmPz.EQLBzL?]zX~ ČUxn9۠dք I$z:Q>aՊⵞpۻ4QnP(b={{eԟ(3g4i՟V:mOP8 0Qq7=?У-7WjW~%,ôB8Oϒ,jtt7;n̂nQ蠹Xb( ]:ִ:Z:Th.YK{jiű&jamUsort=YV q4_ٸ;֛XhZAߍJ~_%u6*>A8#BZ)>=ߊ+@FANXC'Baѻ!EAjY񎾳ҟڅ,T@-:!\?S / Ilk5>_XǴo.N@fUg`d&z2a]6aR wCcf#fhu~n$}Tvp.NCpYlo{YHfŃ7НB޼TevTiF;uwfn#t듿4p纨 63eZ E `1 5N~G~g./~w c;&A-7xOI>BrtG%7=1d-af.sfeqNZ!H,)'™NJS%/;z.3,@~ҧMH'b&BvTܲz|nlB8sk8sKVDFOjV}DܲL`2B.d!d.2Y7|\<n| ;5I;>K-0Fm>cJ{4'i#,rkImeMϣ`丁jU65`%cӜrwp$AR-/? W\K_x! MdsB? f~N}szrNDvBtr Ul7!UD\݆# s2?z;~dE& dj9Ng^lйJ2>udC#1@C]Cf%riܪ>|k߲d3+%fj@ icgVhN 2jsZ%3/|;@^8r1Mo,XW#?>v"TK;Q a)/x?2 R ԛt6, 7ڗÍ[ CH4g2V\n6O? KӎZ?S?>KWk;]d cG^㧿1"G:odb#9`f/:*! yCf:][f Ag~a۶ '%p{̸'c#;5DPV0hqb:*:0NxpF(*L;ξ9A[yîꌿ'6;G"sMĉm+1_㭳H.iD;<,1Q;5GS@f{crN8*Bf7SҢ>5uX*|AliDLŧ*B](z-Oo.A'Q9ab룹j8s>CnMm+ȑbe-g[!űN\xGI`laսn),ZPGkI 4۩nvv Y,lvZ,^Pb`4X_b;v|g꫽oRw0Og'.ZYݲmTu ׏-ŏ g>yj>DXQ5aa&/yf"ӝk$:t5}f9b"$lEZ|HkGCrjZTcn`d>$wtKsw>|\ّj#)'"+n M#S5H=L;!izS8>S/k-Y;'LF[LKȬ4e͵=-aDvHATIg=l[&䋚?Rf'UDde6@Z{h# u^s~m[&/5 q8Gj?X3X]mU!a[bKqD"wn%2ᖈ Rv*L7ҍ(S;"ߪ۟1 /l80_ !.ćv@qq>s0xbR9MGJW)g_<^Ԟm? yk*(ȑcg$GrffϨ> eϻ'/ mDnǡwy)к0Eȓw}YjΚ.8Ϟ&QiݙxH|OVd@$Sv)XV&sABENk7/慈n 3ҙJKg%g2nbH5b ` "񽕑賬%,a.Iqo~3cgcfI>բ-NI֤VvdOuyP#5 FZҐQ[((M_.i! 几zSYSfWjK]Z3I:?:(7^9.²DgYc/I,yl-dIpXxX"/S14֖SaO¦p?4JRZ$} <|0C☌@3ɘ&%/%aL`B :F|NLwqJVtYIm𛨂2y]O 儳:YƠ۠$J?== hf~R4&! hz'f懜?`"Q3>9 G.TR|botVa&NP%![<#X"2HvVuE L8,v> ׈qK|u2hq+\{ca'v3ڝd=# Β)e)IM(IOɺ=Usl}*bynj۸)`Q0ěyC>09D`bU9Sg R2iO _q*Ze;ީ`r~ff ~Ԃ飽.tnF񕳧~ϤI|hv)̬֔v*R2Ax/av> ѶÜ7;Ukg54ާc{JzyIc%6[1-5K>"6"W&nN~3;"1Fn*PJzuN' 1ɓJJ ko=41#$~ݥSc މ3^27PsNXjmIWs-REԘ?M6m^$kr܅nϨJC=&yE g&Dᠽ01$13ܻ$L}1MiHKÿH$ t];,4i K6ӔM`!^3b[a'[MTAja”S>_Lgv JSdĨsƒdB ݼDà%tKbk(:&]վ ֶ*1eZ_sCuFwH+h!%?n|@~/X~7r7/䇙?1 Q4bt(0y00|dB ^, T}4z% @MqVst*`F$sgfm\HJ֦.cS[=ƠE',\a`4y9/\ܜ =LL"Ϙ23`#ݙS`UC2fcS0"2zr%ً=9xs=3ۭF*|ga*EfS׋qg9FEiV$ ˶Ɩ8$e@ &懞oyb'\60 I Ob:wyg3/N)i8js["i_LA=Hz$(Q}9%,*ؔ )쐗5"}F2& #%+(ęEve硼ehxc7]rjWգӭ-%acoMS?!IWZv=b]_DU"/irk~ȀOAOu%r0e6j4ϋ<^2|Rnsv@q*TI n@aD *-9'"惙,rՓ06Lj6w0J7\)6X:Vװvbrn0 KY48+72$PvNpД-ju˙$AcXxhcP0&dQL&6Ք ^qMJR4m F@Mj`C FǔE?R vP.%[LċD9$ -$  ]oNyfؽ9}檰)%ƨQL-L08t{^:ӄ6ܲNv LDGF d-A>Ko7;砙8[Ym%QjF }+Q9y}`Q 8Vr+`$Ʉ(Uj yNINZu\Āَ¬7L= E+͆9v;(%4ќ%Y}Hr33N?7MrMP^!&wj,vW\H)|W4q[h1!`5yca'DY&c14dM,^`{$eZ+UV }ȃiG$Sn?{wd+JR ̎T]QQIri5wֹyZ"2;}Ss&jImx dɁ:\;w~# o0tEȭbq:608];7Nj ͷ:ߩeO BLIDS"]|~,F:kd") ˷:_O W[ J[:nOPP& i Dl!bG74٪37un$%h<3z4X-4#9C[F5޲;T=o~ֈ2BI3KL%[8Eɜ'@ }e& K= Ԁ*n-2'N~u5鶑ljl}bǺ6OdxasqVHʛȲ#^Xէvq-}* O79^%\ȴb Ш>ӠA9_NI0fZuPS[W9IP*XI~NJlGHlKėH``b1%bA.\,"KN ΙO_atU [wWhn"">V7I':\δ}6V}rӪG*x%%v̬2Qik| +sur X)ǹ:eG"Ӊt!^" H'K*ǍϷD?H\FhtF_^sO"v[4Oy T*H \ى ¨I`Lzt\?{qϙ7dBb+K,jX7F}=l܅_C֑ !0?ZTtAOE)l>+Ga2~!ҝcBb3A_Q~ZB)e&%*7%pm%^BkCP9҄Wo[0껌3X:" Y@λۧÁjD;>^``FF%ȤMH{G`5Iih{e9 TU9Xv>QݞV|dA #YhCkw8}aMg5vy,>AtaZTwM DYp'Ak~jV'>.,v8$5J|z n[>K=1Y ]Gdhl`,]jX$Nפ륮 _Q:?dѨ,rkCX |,tȈ!)=1kZȄ."Cw|WosM3Rm `0N hڂqJl9erGVՊA;8'z;|Ɣ[90zQaV';Kbk5E]g^-eTM8@<:I1w+ЃepM L"Z^얍w!Ƃa(^KlAʏVLb2I)$Ӻv,ҊVOK"ͺnp}q }zR3*אB(@(Z}#vN2! ~] R4IdR `TDuq#3z2tϦӕi_Ƌ>{0n?eZebA)%˼68:39P).kƆ*}ڟUoih.By0=Bv6w!K@? TxxU@IK'ʷr)58mS7OUGB"ݽacҭD:F7Ъf׽AцMz퍷GeZrkq"x d;y tX-t<| U),Ź|;z?=RHN(7ʅ W @(aW=됝 ReMo3jQn!\@΄HB )^@v"\!Җ=hO@Ej{qSTg L2%&KŋQ4r=W VlUlD.&:7 eV ƆCO } MųdF#Y8(HKRUN!38-%Wu&C+jwĎDW$&Pxд^7$IY .P4I[~6Vgjz0h36䂋/&,&amQlHiᝊ5u =fc8j3NWt'SZҖ1q*,ղLPOT6Q/%9g}:)CZ7q HMQ\U+XiU>ױU5/7zZɕqj{j0J6Ke;VyiXAn҅*tfek9)L/i$n gSCT}Lw |Tkun:qյ{WqҢvt;#Te&[mRjEYҡC#E; "-i迄D1uNIX.' R61uֈF f,94q;{v榫}GvE>mIZMHč.vLЖ94\q؜5V3z$Q߃~N^A}UXD+V_{Ik|V=aիft$ӺL]wߺFrB+#+v=x'N} @TVVS?8ߗWeU7}?n.ә T} i=jw.V;~>u.vO^KZ5}d4ڪ{_VOq5slAK$^>A? r Q[4t[~%DyuIbDҧv4vڬ>tH#hR- pVpAkL}if1c`Y&PN$$c1vro?ttW0 `ܳuv=QRf4Kd !apݜi_ x#a-,Aqx2R-R= C"r=Ruؓ=YT Y"`L}E5 Gh;},G30a6 ˚%@eZ-7Wq('x ɓ KET? ))MmqۿNW>76,6<)ԎAC_̡3 X AWͿBcl?#gGw#o{j#؞ݍԍvG^ݍ$xuf}qt74]lv|ѧK*G"*WGw#:G?Gt7Y(%޹y鋛)fC7xXOXæn*?w#:⤰9OwGǿwGw#:*Y9sDw$- RlAie/{1ګA vpm 1du !YM_Hb>\bx[gCAQWÇ gxz\K@< q1?w.JFey: mLdX ҹ#}-DåvzMI4͆k<]"@wDf~A 1 Dži&tmvxFe,ye-sxvdy!N<8әDN3&ݺKK\,$O?Z/;YHv'xZrdqާx'hO zc *lU%`po|. 6KaIὃ@cɚ(L`3ˑXTY/)}GW(KhZ^{ Z=m= k:d_Z?YPj[[DsEǯϟ' 5O 2^N(d V)AN:ce_Ğ9hWH홶)t+fڹe=>:{Ƽ<)?X]0x5Q/ ɐ/r'ԝc}aN ya~`q !Hve?X TB 3oaNyÜ +ٵfzD77tz~`a+cLXcfSAuY*jJiLQHLz"_<^{!"_0"ҙp~:F?^-NUuRϹ"(>9`0=(kA@ߢU^A+49BS<$mfN:qva*٢!TP>*UɴXC2e="o)(ʝ?mǛ&yp e(9豐ۦ a[M\/ׇ]ՐFAal.-4u)fJ3 NZE{K 4L/ؕىl(R$+M@O_#,%Y%Yh'QgcY^h#tb݆ޑzu6"|QҞ.Ckxm&j LS}AJYJz&أDF̔tKP.'qAn].a[ h*NF3/7kzYYx%zb㘖w]d5F%lggHO+y~_q0f.HSġ-ʏ쵏Yq ) evOrMPfANmd<ULRȷuX] uBb8Bbi"BT$H75 Pn,fȿAȗj_H G^p4{V;M;z0[`=uXН8@t}ڤCj|<ƒl?9GgG-QlIo6YqBG `Gסgs>d:sdV~l0Ks*8UbjtY)5:YR_|ZSséOKhϖ9q[~rzIKȌVWtohu]%j 4|f"B9VuM2BS3c)CH#o2c*z=t-E'QvLvbN5Fd*$}KQAټպۍ#>|gٌ2H0wbYFG*P*(! (KI5RLZ1Ru *=O \a]ݚ[SaO,ڳgzr/Nr^y3e/!]/|ɦ93?R˩1D6u" /+f>SۚsekGqcDf"3 wԷުٙɏڔ'ʺ0aK\5FlpʪBvM^Xo߯\!(e'*{zjmQ-y X9 8>deM2@Ta<Ƀ}zz>=o* bq-IݓJ#̫"yaV" f|3~b<3=΢~֭gUQoCPDlIu9kԢ,rk-;MuDBiw,MrGk4.mlar8ҐhBBx @3ϖ[(/|w5wM1}ؾ 'yvR ڞG;vn8WXXZO8D۶b%'U1)XS]˩:f*05a"_aX)ϝ V?U# s}@ѼG']gwƙBw쫪<ƽm-^S!W$Hbޞg, -UT[ښ憛CZR $"`)[^SRkn}RM0@9Bɳ]MvG#@O$R;eozb[LqHVn>d/R1=IJr(ykb3{%Y/ z35;D{mͮޭ-f56O֪ mIFiAYUACrYў8Bp{g]_ľ jOy8W?oZjg}:Ax>G{R=͔75j3 rL)eā{JD6>Y9mrD.OԸ ) E90=Ƞa@;L3'•8}/'6H} 9b^ s&?I/5lBί"MOn<>0y׫Tꐈ,.Ȕwiz#9gy^XmfW! <K.]Xώ5r./)IrEA$Caxb7WXնt=Wf4g&CB2,Je;&r Qed/PAEPL|U% ,4T)0 L=Q z=%dGe %(.3͚v=`U}LV@wP1ΓH,PŲ ƽBYu#m:޳3 5ՕzPb5_AXD5A`9Mƪָc7|fp6ml0|F6Ìкl?Elyθ{9i]dtmIFkaӿكVotd.6>g^k;aR2UDD +O_ G) iKYV7v?Ϳ*ѪzSX[!;W[6ijT+~8>Ms+Fp h7Al}7(Ի{J 1ܛʌù8p/.5=e)>Lɒ:9մu qV WΚS-lǮM䫌pʎ ,!p~?݀{X@65(+Q /5zvA؋zYk|Bgl3Z3j1zh!ϐGcj83ccvBdSz =-?jBc<ݞ Ǽx#vV0±U}%SIЃS{y!.g8qbݽ6T],МwdvWEAG;7WnI%~-_9JyDOs|diߏtizZzkDxBh; "&F pxm~e[rcڒ؀&m3B=}re [qwj{T.x8SS@36[q^S3ÑdB֊vU *T+A8:ȿ.I6zWcW 3\xjd Y%{S4N䴻y63|)O}MGVz4s[17MnR[@b^v ^SV4 Q%M8ѓӲ}>q:80G73yC-7b@xZt71p06K$pfs!mpONJ1S%8UVhݭt$A+_/+jMB(׏?_0+Uj}_Zlx'xc)Tfj j*h\ c\a&9Is$JE7pq)#vȨieS&<ƽ /<Ӗ mK@;m e,x> ȑg׼T ;3Dz6^h4=}a83;bn d&҃] mLzbd*7xNl\wFs0H7MuSd.@wy=+Z-5v_pدǏ?_v(}(Qwt@lyXc1 @ 1N 7gOHuKÃ4(BEqԻU`?؛R oprBmnhw]]V<=RKW!˻afsJcsCQ-ޞY9Dl^Q߬ƨ;)#sg7j~[r~N07SbfO#ipϳ|ˍ+Tû )N_+o߷W> D?P惔M֫{l16sVVв+ԛ%B?1\+ᮕÖt*w4-yv#z˝_|]5~+Тkg4]ƼWЯ3,bES#c)W{.z8TtU?f1Cm9\WEShm-H^T$ yߣ֏g&}06籔MfCBp펎gkKt_4SnP]Mmq)pPg:s49"7EQXv3߆D2g3rѐ{;m0N.ؐ.hMkl,kΨK1dFZMqٌy?#y4!#|zvu&W<خ NˆE]'hpjߗM]&ӏnA -C??[7Cxye}}˽,᷶.П.l#ofh0<6i_}P֌]iGӉ2{=^OMtݢ)0RN#[Gdז^,żW1Ch> fx9\30`GW.yOՐᡣHZGcE%sKf qțKʚ3Zb+7p 5d`B:p]:aT#lcˌl'5STHF׀a~a%(bc>bd`Z+$/PA2xe>Tep6BOƜn(61v@ agYe&Zbε¾+OL#Op( x.,b%:؏|;@;|zG:ۑByE~:.lV2+T3٭C2`|QdN+hnfZ *Y.G8`Ns+ C3Ntzj@|œY=EI:[;@tކݍ'F^6ttz*h٭wi(ɮP+>=8vR v %pW:ؘ"0;;|UɑJ́g}:7E/-'͑+TZ/*YH1*ӲGǫtrTEn2m59MmrR7.t00\C z/Q4A#yTm19يh,5)?X b{h4S CXS\Ez~A,WY;i0|U*/>V*X$ S0R 2d@u!gdu/*cx t݂~c6Į$g*ޤbv D'zV &t:r+S={|KێDBQ$la]t*AbCHW*Iؤ44(+ n"9c0W\|-JE3 cձ$+X:f\/9tM#0\: TXRSCSec*ީRz,ڒF\kGbOAtУ3Υ'l/ RO h`*kȢQ_594pߧ I+C,8BHW~-VO\֛l'q|% ^7HѸ)* LTgT$Y[Yg]_shvuDOW%1K5n*- Iz M)(q$nKAR=ňK2PmL+]`hD] 9TG pS'3켛& XbH6rF/Uܝ yBLqoI0-FKO`&UEO⩌=ҍlEP$U62NռX!fj&Z0UCPϱ+FhS8bSq°N/OJd`Y/2a&5Hbu-yYLl6J55Q2X/< q֖5s Sf!zݨ=Xao Q֕Hx$̎ $΍2+ڽEGfEs-ِ8W6D UZ9ZBz4ܑLռ9v4/FJST{\ ?9g͋\@Z9R/eJ24S"~;e քcV2,Ir컿#6bb W6(0H) ZD%W%ռԩLVt|Sld/JjX4n鯢ƾ#z [0k&9%!B[2/Zn[UE(fxE5(Bg ΂ZQhy DK#͞Y}-cJ: ͙?dʐZWPn$kl`XZfUL/pcGKJK/4˅ҍaM]Hݙ)F5ĐbndU*Cmtl57Fi 4[)ZЇǸkƖ#ǒJ#/]q%MQriv>fMgͥYqa>Ie9s= GӀBk@lgr.sI$E8a /y{\hijhhU"vpwC_>I}OiM2rsSAaG_V4SX U}(Qۀ-в|E-ˁN 80D(Ę~?~[si똑8 h2Abmj㣇fQ.@cY;߲84KZѧ(X IhCtĖs9U;0!TKuCF:LLI܌ŀb96+<2O˾+5J -0oL_wk賶,I8ާp\.y7[bQ<<{2.g'Ol$چ";\mFly@Ul ӵCx <Pxx@68Mpl&y {ʃs,<Aٴ&o@â86;30;@)9uN=y>t53NKTB??<@1\􊳎޷ Ab63Q=p5,QO xzY09<19d[mIx/hr8²?,s|]'wh%qm?b9/?%Q=s>@p,x-`ad$XFEMgf*UMC,,[e׬8µG)'T6paUCb kO},PW̤K"NKie&9 (|lSScB`ۃm TӸb45 C@rv5.|i:`$<9HZ=f) LH;D@#bKX ^!71Խpq cv e7j9 4a0CJ֍؛0QyҎ( ;ì-gb&^!l , 6(IN~bZcCbvx1|}/-P)lf #H U\ۮCZP5Qqκ8ߗ? }J/HIj@[apGZ$"jhH$H&d,^? #G<*Kx+xlRܗ&7m0VYM{vu5daӵgL;8ףkb)uxA1-Њ_Ol7E0jxƭ5XڣcKKӲŧ;M6cy=_uªO2CfKJJN$kŮG( &TaXSrIv3e:g21oX0 ^ЖuADeLi1< %ssbj! ,)3@tC_4sZzׄKAPR'[7858(i%CM<>ClQv>>I??|raOoWK$ )~[Br삞U/o:ͪA-?JHu\ qҳVeDЄƋ 0qHjt]DHED/Jޔ_De`Q;KKD@6ot"ˢTF9ފD)Tvr$:IqzmIA6CMY ͍7%RKS(MYD9# R clM3'L.Ւ&?/jB-gM K֕"5f֌O4ok2i"Ds|]"Y[ 5"kMHwM[f̏5 î!r7ovN3g}> pb1!x\ՃJo.0qrklO1#݈0>&eʭ<A@+io'Grlyٌ9Y G>;}u}>D=>0JKefO--=ONx9)ϖfy+DsPoN@Jڦq@oŀVcj _Am̢K-i6Lf"A!%ʃ4*\c(J'n+[6=DH \=SwM9M#kZ5:w"DZ$!ە;I䪉 .oi e!5dDAeO]"uCob2 MQ~ 9|TF+`$t~UU4l[*9+gDd)#;jVh]Rx~%N8L\Cy3G윱&7S_!O&lЌZXt{ш_r y _p>9`|AkuQxPNTD#GXs6$ 8dI"Rr\`- z{0ȼw=T炂°B}I1/VqlTFbǔp.0&Y3_UJ0Dl4oDoZCEt)39drfO@IIqs|F!\^ !r OE`r'9"2s3}ۛQa+GE8E"7~DFO2,0 >4ngZ2R*E!NtU@1#2Fް9&Z"^!gڊ?HP`B14a'ȒnlFB9}=7[ge2;oI?"S0SډXzܼlr2"N6:nf^њFf}ʲZd~X>{ʕK6~[6گU2v%yͳ;5e풑umWmǷZ?ruW RM?mO}0El)J<{cl?nMւԤm\42bKf ߞfiK{(6ѿ"f G (]zxcNJ6x]C[=sLuIrcBB@!iКd$*MV߀>}Owpw?77N`(+݀/D~!#lvz>AUjjp uۮ K_`U}%(\"o}뮇 ԪYR7z)>5 =#jT!gq3Ƚ̓( TwN;d=E.{DI`th~8b#X#P:@jA+26RM2׮F>XG HgM]نt_V(NftU&A鮒v @</^B#,k0=3v'>%&uia2>UyӜnDs\ ;jv.2AcTwN#;P~ bS$JwR 8CM3I2it\k">r-]Z(!K.l#86#Au%;:5W$z&y: 723ͭFz<]6Q;II s瞾 11\?Խ:AAt쓥Jb&A>ԸȠ(lnWTo6zoͿ$u=M`2^! Gu) Tb'М8χ)?%Y|y"Z'% Ay 3T[#y`Ӛ0lђ-}UMO:~'CAIS 1Yr$C0Hך磗LzsQwxb՗/NOqړ tr!~JD_9.g<%<$ -r"$V4~t;i"TBJݝ6j\V5`*+z Υ1*:N;Q˄;\i42y˕9#:i ca0Ɏ q0Su}0$Fv.Zi&)H'hTpU73G  qHlʌcVexdI)2snmPXgl˕T]+g$ƺ]z=7dM'xny{2oV<䋁݆ Grp{ŹRɷ. M8oV);ŠSuj}Ȃ `m[> e;vY'Ofp%A4R0ydVJ"Z'9C4EMzn. yl[tå-԰qeY rvvdz.ߖo3Umsڗk%dg)#df·WEgRk(dI<5O Estp_B&26+6GuakE^~qRI1|Vc"d,3v?G HȽWM!D6}mt|"so0@ET vA!3?9Y`3VMJc ~NRMLgkA_=ݤJ_l.ISœQi){gH@#{ |;Zf ճoJ]ϣ+qV2F?f4(UXmr izq#w;7xb:';R9Vf,9Wz%8=(+`j2et bŮY;GO)B./kjw?{q_,ʊ !2+M".G4L'hVsVOuJ̱'UsWʊPo*2yEd"zZFˈ{J $dW(z,3%S3RnݚSʠCA5(cPU8i ¬؝8ƓQzŎ'Y{6|#ٗ]Vǧ+ ±͈Y)5jYաqT?9F=ЍYjުy:b~Ecouq6햩Q0Qz/vL0 'DfB^YvEXvcç7r :_ ʠT73^c2oz>H>]8]ēG JM?Ǐ. =p[Pw*f6%3ޱ:1xX'<12>>5`M|Œiȝ\Kk[^-12\#2խ<4?p(F~NF}'ȣ;{(g s@\%8DI@Ś,o<}$:sd;M#V"{uwvPO~ 's}OZ X{0Ip"_~gOh–q%H ܿ^rgD6e x{Jt> Iߏ 44 o x'[}ϩ_/jVw\{:1#F##}[3?ݴH.LNW4,\m V(,<8lh`ӭY~|;a%0ÌZ27oL=F1֐}ߜi20⠟HW_妠`> /ExtGState << /GS26 1251 0 R /GS27 54 0 R /GS28 55 0 R /GS29 56 0 R /GS30 57 0 R /GS31 58 0 R /GS32 59 0 R /GS33 60 0 R /GS34 61 0 R /GS35 62 0 R /GS36 63 0 R /GS37 64 0 R /GS38 65 0 R /GS39 1252 0 R /GS40 66 0 R /GS41 67 0 R /GS42 68 0 R /GS43 69 0 R /GS44 70 0 R /GS45 71 0 R /GS46 72 0 R /GS47 73 0 R /GS48 74 0 R /GS49 75 0 R /GS50 76 0 R /GS51 77 0 R >> /Font << /TT5 1246 0 R /T1_1 461 0 R /TT6 459 0 R /TT7 400 0 R /TT8 406 0 R /TT9 408 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 52 0 obj << /Filter /FlateDecode /Length 53 0 R >> stream HWr8}WJE4 H[&v\Y[yh v8%):[= @[%ݍӧ"񸐢~ڮCWoDW/.oc%EPBfYBQ,R^<,~[/LH~XD K%V,øKE/`[2 3OL[3aVqz¸eb\e("~L׍iv|{JOUW at\8[ a~TMqDJ_ (P&5W?ۣҶ5_fSٻ&H& b?0k1 >Dq+Nl^ M-}ͮGɢ&T~C/g7G\ՑkŌ$h#z]o_z`o{nA7Si4݀ih_K!gNB/#LX-n*[H>ϴ׺R2iϖ-y4ܷP7^SJ8ynjྫྷQU}_s| B1VSݶ7FW[ܠP7{Iٻ?yMKujgi)w]ڶ?][mlIzU۶QU?=2CE#)D-2"f 8.3%( XVY, PL؝%}Yqf{ǧ}pOݡ}^6vnF-]MP)_GS{VZGH="iH,CjP?us uݳ|z﫺5wהhu[+VVƖ/7hY6z[ushcⳠ薊tI= X'ҵj7% :@ډgZQ[&Em*Ahi:K)ZN{|>Wt2|x t]^b #WRP-DEBDžTtɲnZb̑MCqV)g){lI9لH>{#i!p#k%$7?`;jPZJyٱJa +hiERs kUa aňR$(w0yRn᧲XͲ.hHG?]|+[o[B[ Dizɲ7EV>{f.̽~T S&n0+6YG6aiΘ6Rnc%"K#9*qRƏ\K@:S;BgJ՘ ~lO]ԛeZ{H{h yI0 wb)T"& HN{{w?"X%xgj$m=ţ 8LM{{d[PK>ukZlQANcj[ВLF)&(-լ)Lۋ~F-loE{Ol CJ0yHjYr춡vUor9p8qydP=sו3NeF @`Fԓ~JYE{xx|<>?W׉S33qҞaAzDⴂ8& Mn6kH{Â8~m~ ;vW Ns,+q'mf;O3qfά7)̛^]Vdp!7ޜ5aAYqxRcΛyӽ› <3% *Y6uRa# EHz:㞪e~& 0fKx:( <;Z/j_>6?`|.WmϢ z*/|`Up'wT!8¾t# ëE)(٩~ʢ+2/˞_!(=ٸcZgx S UDf!G׬ lna%ۥQeL VbR_q@STE2@ 7>+T<#592 Lٰ @/qtr,edȊ&5Ջnya:0){ba}oK$Eb8N튈wlnodd,: jc6JJ Y -3-94[03T3eQچ,M\>΅&nfHy3 ~ox]/kT ?N#ӫt֦Qpzߟv^pmpH Ms $q@ S(K(З?y/X-5͟?P>NoG:?:{|@o=g,.y~gf؟5@Ɵ7?^$З"L{H6Зфoع<1oD ¶`2Kπ#ZZ|{o(~*Po7@^Ɔ*6 IcX$r 󄷡(,^bL.w ; |ΓMOCAǺcmŏ\[UD R+@# y:4ca zuu_ӗ1x@}K^ӮA,ʮ ۹6L]<ˑz= w?Dcd*5b wG8pWﴳ {pyG׊€3pC\z3WdfEv1>> endobj 55 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 56 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 57 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 58 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 59 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 60 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 61 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 62 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 63 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 64 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 65 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 66 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 67 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 68 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 69 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 70 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 71 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 72 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 73 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 74 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 75 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 76 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 77 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 78 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1193 0 R /Contents 79 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS34 1231 0 R /CS35 1230 0 R /CS32 1231 0 R /CS33 1230 0 R /CS30 1231 0 R /CS31 1230 0 R /CS28 1231 0 R /CS29 1230 0 R /CS26 1231 0 R /CS27 1230 0 R /CS24 1231 0 R /CS25 1230 0 R /CS22 1231 0 R /CS23 1230 0 R /CS20 1231 0 R /CS21 1230 0 R /CS18 1231 0 R /CS19 1230 0 R /CS16 1231 0 R /CS17 1230 0 R /CS14 1231 0 R /CS15 1230 0 R /CS12 1231 0 R /CS13 1230 0 R /CS10 1231 0 R /CS11 1230 0 R /CS8 1231 0 R /CS9 1230 0 R /CS6 1231 0 R /CS7 1230 0 R /CS4 1231 0 R /CS5 1230 0 R /CS2 1231 0 R /CS3 1230 0 R /CS0 1231 0 R /CS1 1230 0 R /Cs6 1230 0 R >> /ExtGState << /GS1530 1251 0 R /GS1531 81 0 R /GS1532 82 0 R /GS1533 83 0 R /GS1534 84 0 R /GS1535 85 0 R /GS1536 86 0 R /GS1537 87 0 R /GS1538 88 0 R /GS1539 89 0 R /GS1540 90 0 R /GS1541 91 0 R /GS1542 92 0 R /GS1543 93 0 R /GS1544 94 0 R /GS1545 95 0 R /GS1546 96 0 R /GS1547 97 0 R /GS1548 98 0 R /GS1549 99 0 R /GS1550 100 0 R /GS1551 101 0 R /GS1552 102 0 R /GS1553 103 0 R /GS1554 104 0 R /GS1555 105 0 R /GS1556 106 0 R /GS1557 107 0 R /GS1558 108 0 R /GS1559 109 0 R /GS1560 110 0 R /GS1561 111 0 R /GS1562 112 0 R /GS1563 113 0 R /GS1564 114 0 R /GS1565 115 0 R /GS1566 116 0 R /GS1567 117 0 R /GS1568 118 0 R /GS1569 119 0 R /GS1570 120 0 R /GS1571 121 0 R /GS1572 122 0 R /GS1573 123 0 R /GS1574 124 0 R /GS1575 1252 0 R /GS1576 125 0 R /GS1577 126 0 R /GS1578 127 0 R /GS1579 128 0 R /GS1580 129 0 R /GS1581 130 0 R /GS1582 131 0 R /GS1583 132 0 R /GS1584 133 0 R /GS1585 134 0 R /GS1586 135 0 R /GS1587 136 0 R /GS1588 137 0 R /GS1589 138 0 R /GS1590 139 0 R /GS1591 140 0 R /GS1592 141 0 R /GS1593 142 0 R /GS1594 143 0 R /GS1595 144 0 R /GS1596 145 0 R /GS1597 146 0 R /GS1598 147 0 R /GS1599 148 0 R /GS1600 149 0 R /GS1601 150 0 R /GS1602 151 0 R /GS1603 152 0 R /GS1604 153 0 R /GS1605 154 0 R /GS1606 155 0 R /GS1607 156 0 R /GS1608 157 0 R /GS1609 158 0 R /GS1610 159 0 R /GS1611 160 0 R /GS1612 161 0 R /GS1613 162 0 R /GS1614 163 0 R /GS1615 164 0 R /GS1616 165 0 R /GS1617 166 0 R /GS1618 167 0 R /GS1619 168 0 R >> /Font << /TT68 1246 0 R /TT69 403 0 R /TT70 459 0 R /T1_17 461 0 R /TT71 400 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 79 0 obj << /Filter /FlateDecode /Length 80 0 R >> stream HW[ۺ~5#.yk"EӞi`,Y ;3 Z3Ùo`wҴŋJWGŞ_V!;4+-cK&_J ObVջ6N`ۧU2lCC#eb%J zuVR8NH"LŸ447,,$5j% ٫PI$E^`Kg!av.I+ ")C8)<C4i:f*{#E\{ʳ%c~2Rg4݄< !j=' < |4mTTm>On }j2ܲG{pPެO™}`g1tCYoEpjS3FVcE!|g$-%O5Zك6ePyu`t B *F`Y'6o] (/xT۽ mDC TBzRHEkS|sHE}R9+k$x"wͽPՀ$̆b hcxo@&!u ?0iL84Q> {bMkJ>B2tTC 3#_O72Uekv#݂H}wJ flkr>1sR BfPmmD1̖梢䎳ٺx*;;5 gHdSUW+Mc.r ~Ic_A%YeشTx%}D Y0KTn*ưz% !kU\Nh3T ktI]m=Bd(!HcLk'jlh>pB=86_CxcxOe9Qy5%;W/n!b"B B-k`X rw&=`Lkj|osכ 6ݡ;'Ư ^<. RJ%\D? ٶ;CbP@EKԇ5$zkH҃HDE4.?"2Q7*dQ<. Yx9s@.jDl}@NL(漨wɰb}.V>XJ>9=\h(=m ZzTE:jlB1/% Kk!kSbQ[ Z; cv=N鱸Q ~=/f>B´3mW1oœȷ^^%N12Y(_M͂F3=s;O;c8 ~y쮗hOlfYER%8 E xxg ?_%!UYٟkCz|[1ҥZq%_D7aC|.tv\6c{!3x5Z.Xٌ;B!4t^P.H{wtt}ڎu bkijf7-[ultq ltƃ+H Frc`#qiEN;83ӄ}חۮU->5C:'4Hp1 ROl 6s./Dgt̏p卪M֏ZW0iG_ mumF.h]f2y?k0jYi|x݃๤@t#(V3̼أHqٶ{MFMm]F o22U4bw^/~Tɿr  q~4Ӷ{^@í c= Q'thn.߹xxr{h9vK^IY5g zc#InlC.HBz=Xu9+Ȣ=Z`cJL1d@ _-M}4 #] Ϙ Exw{cS] AX - 7G[Mv"EY+HF1G G7Evޞa15%&>!Wx uд˧}D1K`'zZx~`@kagzBҖNH~i{<Mß>,{ 2#='4oaFa*ōG)ov14kbE`jo*_c9 rR6=:nF>/pq2; ?)؍ezޤWkom~FthFZNu} M|ٞ—'QPиh']?m?Xjm -ië\_D٭o"Y Iq H$\]^+𫛥:C)6$zW,vy44s1@%5\Ԣ1^D’AeV.Hܶmx@o||tY^=gGV= ;=)V\zXv0IG'6͕r%{ fP0LԉOvFyDĞXnOW*lfwrrLZU-C,(;fRƀE?3ʏ߸gRLwm.ř~ Vܯጇ㼡'u2n3H0g!e0;Z_ls/?+g@RYp".c3YLIۦgozB^hhSøD_P܋R&iE- {RǪt-iq4A6ZGIOK iVsb#WJ}SAsgUKl=ȵ@AElXIU>BG9Dذ:6<Ec4kH 8~,hЂ#k\7(wk* Uɾ [L˳SFk5RDZ@F;lf[n_>`YsƧ~X^np? xxXT4jKÃ|LEl4g@*eC-{i )Ms E!t2轩7l{?%ג/j4{3FZf\Tl*u$ZlU]քPʴBǓ&̸ܸܸk;3*.gNmp,ߣުwMd**,w D!2 C+ dc _7[REOGxզ U~~fu.͡e铤TS+(ij>YmoY啚a*uY3NNPռ@O~bpbT D--D v[-Em&>Ӏ\` ֶQ ﰭI!oN ^͉8)Ea{^|Luus/x߉λﶇ)}x)4.rw]F~9H4g\:=ts 䆚|^sPپ'l/O` $\Щ`UayMcmޞohuR_Ûlw ($~i,^2o dLcZ/@IT1]r >"|MCh5߶Y7W )6w+ך-} ЃeC^] ʌ5Ffw xH}hܢ)}8_dl3%`&E0jTDwN8e#Gx3. H(3sgnMt+vEN IfJzyFgj%.hQx[dK9GrC x|9vLAH];1+3y&r5 tI tY=2.`F+l>4(jJRƯu"#eKaDk̴u )J9&LL8IXǺj$beh2 dCڒdE;0ߡߕFpc$. AjTq( 3Č9l u| ; n %a-Z6+WZ7OR(ɇ/Čڡ^V 89s\I$̀8GAfH/nOV^]5<+i$Z"a]SȚ.81E8.^ƱU[(V jKkzFnM=U#{t[`>L zɹ^SƖ9'k ȶUIE0@ih$X9 Er0υc%cm SJvÕ,IJ뿤c"jL8c$$*N*(Z+ Q.)X*HRQrGx-,^=Sjp5/Tc&  D$E&>ZƧf[5XIe b #RY;z+V.PXd=Z!ӊPE,q,Z0qr;00 (cCŔ%K>D-CyHxg2A iLql"+D73ԬUx\R(*r0#QvFF]ynm|"a6%Rz^-RFEXhYȸU~'id`*'(而g)k,)#&3?Ւ]ێ5;Z7p^Yp|$TD#\DVc+/u`G*dT<_%wѿg/_j^Svb=]5!&IOi''J6i4D0 "08p "$woo[2Wtdԡ|&5V^V'i1c6ywUeTяHQ+>{[Zq֑ .n)E5{&ʺgGfW%gkeYd"'oQ4$C i@П \Gk_:bZ_9 U3T vc* ܭHǑQ+3M]}i(F+:#jVa}*Q3 ^lɳATk ?Ej9RRDia m^*m~t8c #IdoJiX=&Uՙ>&pٳ'V26+v8oRcψƴϿDRҖK@L$ 6vhZ|hWbPXq(E^>qƯ+Yp a[nRweULqT9xjpafu6o}HPֺBG&Kt]"WCvuN>ƕZ \,ɩm"vh\mKϩ~Pg(Ht9]rc0 @,WX͒- :-UMMTE9l$q}{TN}#.3S/ A]9ljqc Nb)QFͩhy},a8 #ugw_bu̩-^`bjEUGUה mOZHsL-5@% bgα !w$ R)6`V.yrQ3)%/ASLfO O>bbxkhZ lYE9ڌm̓V`9c {۬2^:7xj <&mzw,&r0:VnBUT)qRX|4fLd`:&@j`S܀]} qG{h]פy]vʾJ0S`z<峏v\ҡzfd3oj7[͚\ѾfѾ5!q#٤q4P|ayv@ =Y;zzO˦eL\~V,Ba6ۡ_#Q Ke@ԍF`&AHؐ>*͙QXvP?`.ևmig}E)8V" dRNX:W8txµҵb7%E}u+<dOê"h#E;@eGpuuyM`$iʇ 6X_~zE{l& x}A=7qND 5itB *g6.ګo'oyf3Aհ2<ȮZ6".dKީ~zwj ]þF3MP&5\1ڵl&hUI--3j!IO*ۣC|ȷ*XRu#~F]7:D4'q'GX-ٺ1AH!(A!z_dp1HH&#^$ʑ4;JۭoVd+X6wf,k@%_A[1(@VੑElH&~=N<]xjH+ W6eS4ДZF^ށPK0 Mg-\͔p=S{UCC FƤuCܭ7~{ప's7RDۚJiҶ!᷇"^t֔5URxL*I`U HMY,t-p~Ƈ&dE,@,vD\A#% ghq[vjl\HCKVߟ]!08g1嚧MA.<y>{XPT)S I8hy@VN#tb84E@+q(%_Qȋ ӿn- Jfc丒߶~ RC]'/{2O~挠W1HU*ܩpd}VYU_HOi.U(C`T)l=3j;80>5nXjÈY1ݾϨijU¤L@_\Lj#P1(=U/+0oɂt)0\V5IxhlR[da!?KbI$-H HWߕwϥܾʫ$$bsƾ5QY @Abwh{)VUtʄ[J2 U'_͎ pUZv{B&p8=rS7{*kޔ>$LX?S} 1}vm0д`"v,K Wm\&ЗW}Ph{?Ly{[1@uA.g蝜izz[ gŦ]BC3~՞I*e%Hĥo6I D7IIꆙRwHFxp>htxt_%s/hr\! t;~ Glg)3{) _= I9Q򵙽ugkSκs]h5]z6S3ok_/)~Gu5u `SP~tlwnr- ^_ȑ@tsg`R3`Мb*ه~1{Ƿ߉O4d#UGgr&DoMyjft$mX.i3ϑo Uy_l 4WLʗ2r?,@d 瘀1 5D|maZ[DQ6Ӭs)=}I%r{ : K;M٨&+(-KVZ@>pk> 9渆(є2X 2/ΘQ$@rr1{en- uڴa-LΧܓjR_+E5*eTE'>TS4E`0xK$#"C4iT[V#<]zUtSϚz>:~”Ҟ [ս=ZWx (R?⮃hK8|j8CFtqI~+"@zP@ }MvF8]q" nzuBDm}JҕUG}Mgg+-FXy[J~RߍN׬,$HRvvJl03*o0!9}3<4Q^V9TxHӾt<(S_m1Y1t|E_D(JN ]\=)ii&}cK9_s-(}un&z!:~|M!/R0`\~G:eyA"҂!^!WPkF9.rHi3= 'yz<$ᘺ|W]rӇMU3s`-b1hOEEPlO95j& 2 vfX͏o?%pO¢|Ǻ {:ƴǙ-'bfQ5npaɯ ~ "Wrt"g= !RF2O:[k[;֞$(h: A+tfش<1=Qơxjk Jwap2xV%k$Bhļ;gd'QDԫ_TA ٌX41cy$"Rt5JQI5򔯄?0480VS)AdT}hE\ٺ3U)>ADtW%ɈJ XsԾ?wh`pb)QUF1d(Lc"@nIDV`ɲr)Xǜ:xS\N d4lXbD]OXNMΩxUSWd.vm0uƻ|?(䦶 hd tSQ"IkD0c!O`*2_دʍ9]xܭc]=M1fA9 l$k9H2"N<Pj 7&E1!ARqZ}K s s(l&{`Dū%ƪm3^²BGVB_Z*M{jCG ūyC3(jC:nۺ}JG%:MQFvF(K8;igTG@^-6[A9 ,pE{xfi4o My lf,}zm4@sSE9vXq eC/#DȞwzr3<I}W6x"Nt~_q=:R W:3b) .bNNyЖ5xgͥEWUp1C}L*n%TPW8e`a/*{ N;Gv53&Lkz뜗GUxDVB_sM_DK8)Z8ҥP):5 $.}mEVclXiJGlq >6~5)wXASh;)%t(U8œlv,‘a=+M]lނ4_lؽN۠99y:Pq@f4w#|Rj_QG|6.ٗK~d+cS +>-/l7A,"ѸN+11Xqd5hχe2%$:®QʳhOϲ5\S:NJ䷿v䑚l{~:˜_UIh}E=4zdn1"M99koh%ʉꧯ#946wzYoV_[> endobj 82 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 83 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 84 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 85 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 86 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 87 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 88 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 89 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 90 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 91 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 92 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 93 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 94 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 95 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 96 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 97 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 98 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 99 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 100 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 101 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 102 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 103 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 104 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 105 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 106 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 107 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 108 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 109 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 110 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 111 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 112 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 113 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 114 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 115 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 116 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 117 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 118 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 119 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 120 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 121 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 122 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 123 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 124 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 125 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 126 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 127 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 128 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 129 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 130 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 131 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 132 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 133 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 134 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 135 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 136 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 137 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 138 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 139 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 140 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 141 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 142 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 143 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 144 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 145 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 146 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 147 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 148 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 149 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 150 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 151 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 152 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 153 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 154 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 155 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 156 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 157 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 158 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 159 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 160 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 161 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 162 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 163 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 164 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 165 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 166 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 167 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 168 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 169 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1193 0 R /Contents 170 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS40 1231 0 R /CS41 1230 0 R /CS38 1231 0 R /CS39 1230 0 R /CS36 1231 0 R /CS37 1230 0 R /CS34 1231 0 R /CS35 1230 0 R /CS32 1231 0 R /CS33 1230 0 R /CS30 1231 0 R /CS31 1230 0 R /CS28 1231 0 R /CS29 1230 0 R /CS26 1231 0 R /CS27 1230 0 R /CS24 1231 0 R /CS25 1230 0 R /CS22 1231 0 R /CS23 1230 0 R /CS20 1231 0 R /CS21 1230 0 R /CS18 1231 0 R /CS19 1230 0 R /CS16 1231 0 R /CS17 1230 0 R /CS14 1231 0 R /CS15 1230 0 R /CS12 1231 0 R /CS13 1230 0 R /CS10 1231 0 R /CS11 1230 0 R /CS8 1231 0 R /CS9 1230 0 R /CS6 1231 0 R /CS7 1230 0 R /CS4 1231 0 R /CS5 1230 0 R /CS2 1231 0 R /CS3 1230 0 R /CS0 1231 0 R /CS1 1230 0 R /Cs6 1230 0 R >> /ExtGState << /GS120 1251 0 R /GS121 172 0 R /GS122 173 0 R /GS123 1252 0 R /GS124 174 0 R /GS125 175 0 R >> /Font << /TT61 1246 0 R /T1_20 461 0 R /TT62 459 0 R /TT63 400 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 170 0 obj << /Filter /FlateDecode /Length 171 0 R >> stream HWێ8}WQh3"u߷Nf`ާd`lGYItKgߺfwvi⩪C_6Jb_4]q\隢]S)6>>*Ct,c-TI?JZq"X4vyۼb%=o|,[(RxA,c;4N;e%DRd @r0zU~0~}2ugQJ\x5g F%UcaaW&^Pg{'bip7lW7+7j`X1bZ qĒ8v6΍ƞ[pvGq"7OnnkO:~c*ǀ4Xm-E^;g?yQVxRMJbTL"8Y8UF C| "]$mH_NTFIs(n\{(ׯ$l2QYO\$nZGIj--왥C 30.|xϮ_;ݴ+J_ٚ.5jclڶGgҨP_׋uԉw[AnRh|%TFƜiHE]aźOi(4J  ȝ0Y萵`4N[@[QIŝVt.t8O%IS|!)S_FA櫷f$GsTLA)S8+ }T8=zIw;P^mRͫ|dL:s⢪/<_D/ ”Yee@}>7famRUXcT(}JT%z꜈!rD1zc< ddsڇt)i .MV^5͚kB!N =\@H8Vzh.DqSTR83Bk9WtW %Ƹ2iAt[`h\TㅆzVGм ˫6wl{P[k|Umt)enP 5u~pH!rv8_1]~9{EUgzbT͑ ӊnf0Bh\˜wMC~B~FA-BB{䚥{(wjqA1"9:0G0иʌ0Vw IÅGQ$Z&[xF$ @-;b3A̠ ڦ+:xSancF!* 0#;C\?w=^;m[p4Q9_<ڒc%paC]4]v ǭ,usw%5VЦFh:Xl>=9\A(qXA V23}O{tBE2*|ԃD(>'?}wC RbOjKgx2ߡd;2dI+*IiHL! :A$hD݇GAXGwXAŚ |En.C"Xg=_#:t,Zՠ&lHr<'AEFo^H%<ۦn;`!иu%oe/TLɿ[ Txb(qqsڝjQ?<#vNԼ6co UPnB]7a=;HՑg:4+?Q=TU3=Mgg`ߤ{=Šz^EYϥ۱Lͻ<&R'ZR'[$+7#bxq_'oR8Yo\ވY'w}ri-<|@ݩEC6膈j'7 5χI>,r-XFq(`T%2Lunv3Y)6v- ՕH0vWo z.ԦI&L(;l|`[;YP+w@TĝL\ T`ħoŷrlDxWIgdV:m+?iq/r1vǻh8z&$RS/N$U2#@RqO8z@y Mhxv,5=.qrD_9޵Չ6[[qPjU} $/kWaan&^v ⛐WBF]Эػ=>;A{=a3w1ma ycAn3/p͇X|v̗H^ %$} k `&I3ŃH6fv!P;죸XH1&1sG  TIlk|' ,.|RWaS@wk "N:A!)9y)9\ *kuX1vG=h<Rwdۆ/`""P_z#֦zvfAתds4ЈIDӜK=N|jbt] W$z^#auHRhb쌏!0~[oȱr-͆ht2Yi;5*ri]x4[;^J2c0qڋƘ0-h-uVL/47VF^Yhb}EQ0C~v[7t3EQI}Qq.UNɃ eyZYF5XYYG6PI—ͷ DJSK_SI݇[LJNMa%Tm3P}KPAUr$'Q&k9XkNoL xA, $:mP oa=ꇧIc<衲>.<~l-vP++ }-|[; Xk_}"ش.LT4Q䯴bQReaɊc@/<%L| ]&=F /f]'v&Vz則2j|/#sk <CT,ggS3=5qNdN%h Efa3@}zx wx>T7^PӠd+uښK4'/yr_A,[W,JCjQO,:g50t95zT}K}]RX‘HN/u)=d=5[h :>Q:Sw*l*C mur,A1|Ϟ tltlڞ6>;XC' G L W탻(g )DЫ3.2ō8zY~/yB͇7ܵZvR;hD,+OK3)C-n:h|AC6> endobj 173 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 174 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 175 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 176 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1194 0 R /Contents 177 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS28 1231 0 R /CS29 1230 0 R /CS26 1231 0 R /CS27 1230 0 R /CS24 1231 0 R /CS25 1230 0 R /CS22 1231 0 R /CS23 1230 0 R /CS20 1231 0 R /CS21 1230 0 R /CS18 1231 0 R /CS19 1230 0 R /CS16 1231 0 R /CS17 1230 0 R /CS14 1231 0 R /CS15 1230 0 R /CS12 1231 0 R /CS13 1230 0 R /CS10 1231 0 R /CS11 1230 0 R /CS8 1231 0 R /CS9 1230 0 R /CS6 1231 0 R /CS7 1230 0 R /CS4 1231 0 R /CS5 1230 0 R /CS2 1231 0 R /CS3 1230 0 R /CS0 1231 0 R /CS1 1230 0 R /Cs6 1230 0 R >> /ExtGState << /GS84 1251 0 R /GS85 179 0 R /GS86 180 0 R /GS87 1252 0 R /GS88 181 0 R /GS89 182 0 R >> /Font << /TT42 1246 0 R /T1_16 461 0 R /TT43 459 0 R /TT44 400 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 177 0 obj << /Filter /FlateDecode /Length 178 0 R >> stream HWo CdpES!{(u0ۓ?h& ЧbKH~1Ǖ Viw^۹mV%/_VHȴWD 4Y ]=Y}l\*B)t!sԫ+#<:+G"Is"s賆"W3DCq-Rh( !$El G{ ww(BSS=?ڔB6o5'1M-tl)TXpB-THŮ4M` -JS0Tsw{|,Ɓ ,Y;@}8!H`9PR1*`VUɊ&HuX$Ivx"WC(nX'h0`RA_op{[?`&KҊ٥$tir)X#U<4_d JƱA;B+5 †x/Fo%`x ރ MGP옌yq8xG ])F[j)Rp!8Ca(|^"n1kڋʑ%rƕy㻸Ov dg2u߹@G~Q1lhGSj?H)#)9\1eQx XX;f YKx‚Ӱչ6ɒz5tuhmr[d>Ɲb-.'cTA:kLKOgx1 0h~w6Y3p[^tR\Ne<@ M!b@~'Xj ;@Nаe! Е9g˱.ND|;OD BԖ+?m}`zOM}\:}5$;x{7rZ'zI[R{βѡuk|{};R`3}_zpmr%]YNw>m8zcSY]02kk8_"__ سjXt땝Nҳ_KjFsY|f,69 #"RJ*^={e,s28ΐwM-T]ʹkߞaRM:䎬>bN%=+ H8g0%7"Α7}kU7~e (DιCp'ty r:X̀|Qfy ̇w.IH/ޜng8 E> Ók$ώ{}Wy# te gB&|E6h1[:[uR;}zg-⥗)k.Jfڗl3|cYM.I؈"EG"#'&' #>%;E4Τɼ! ˍ}$H>$Xi\M6gADtyqnf:͢K7B)z~LW$42̭@*YqRiE•kO*96iߪku UyHʹ띏^V]A3Re$p/Z.yuZ@ll~xdGa) SnÙz/Y$ }lgѰnԐ#h!?/`8h"0H`3qvlnOS3}Ң^w]@HF Ur-s2)1ȥy1mճGރ7 0-.)97J\X V<:ʺ"!b@C%>XہDҟl5׾;p܂~GNakHb~ɲ5r"M(5bnРRZLiQqn07fE̓$Xh}.Hb.o((DjFrmD*?ȩ<^m.3@*:Z<8Ǭ0C4ȣ*Vp aP?u4mN/>9UVk@ u|o uG! CWBx4I˪ftFIBG "q^gP؆CuiG_^mP2RjcBSVu:#X!L8qE脇H" fҦSg"貅>d4 l gs+=1 7vtC,I܅,Q"@FqmdqU@(8v.4BP0nDEMC\6q[- ;A&=N@l}t9ꦫJ{qN -Ɏs /3.bSJb%[Z0ӅߏW=_9YK5Ba4#vf6)ʟDqB3)MO555!ǩL@/> endobj 180 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 181 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 182 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 183 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1194 0 R /Contents 184 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS8 1231 0 R /CS7 1231 0 R /CS6 1231 0 R /CS5 1231 0 R /CS4 1231 0 R /CS3 1231 0 R /CS2 1231 0 R /CS1 1231 0 R /CS0 1231 0 R >> /ExtGState << /GS16 1251 0 R /GS17 1252 0 R >> /Font << /TT24 1246 0 R /T1_8 461 0 R /TT25 459 0 R /TT26 400 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 184 0 obj << /Filter /FlateDecode /Length 185 0 R >> stream HWے۸}WJh͉ԦRXovj CB2(B8 mfHn> `Mjو~Ud]aʎ&᩟r&,4ursesM HَXsi L a9?0? nPzƞ' ? '57!4synCv@ʸ`;Ia)F<žʶWoq+y 7݅޹}=#z|c0CM >b]^A4̼& X;X)0w2e%-!i]FNE#˺=kbۃ3iO|9,Rӆ2RrxAfA 7S:Zab@S9CqDZNR7; 2#kk֣6pAOӴЗ (mpE v4w k.4L\yǴwRݵF4ɾqϲ$4\`{l!z#q41:`Y{N48oEYCh g6Sk I_$Cc¸Nalk$<5\θ8+ )[~ i9Dh7,cak'=q)Fyi/ {N\J"jB:%BƆ Qn'v:KV{X#ezz/&aO6ؠ:hʽm3K ڳ h᳉@Eۧ?!<h. x~r'ZEˇ~?E..Zy,Q7N#ZgݹMx=込MWF̺{Y/2&H[@'NkjWXY܁Yz0ޖeVM^F*0\P{yD:A:!(|4[P Nh=in79Džd[W4q&&=NqkW>S?e#^x{EЎڧzA4 e"opl:xўX_Qz'٢$/;OiOn"jIjGt =JY`sDZ`q5 h346PI- Z'dR{̣zh=揌> endobj 187 0 obj << /Rect [ 131.34 180.53999 143.88 388.92 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816145) /Type /Annot >> endobj 188 0 obj << /Rect [ 143.88 169.2 154.74001 330.36 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816145) /Type /Annot >> endobj 189 0 obj << /Rect [ 180.36 180.53999 192.84 388.92 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816154) /Type /Annot >> endobj 190 0 obj << /Rect [ 192.84 169.2 203.75999 388.92 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816154) /Type /Annot >> endobj 191 0 obj << /Rect [ 203.75999 169.2 215.22 232.8 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816154) /Type /Annot >> endobj 192 0 obj << /Rect [ 227.39999 331.08 237.42 388.92 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816154) /Type /Annot >> endobj 193 0 obj << /Rect [ 237.42 169.2 248.39999 218.75999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816154) /Type /Annot >> endobj 194 0 obj << /Rect [ 251.88 180.53999 264.36 388.92 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816224) /Type /Annot >> endobj 195 0 obj << /Rect [ 264.36 169.2 275.22 307.67999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816224) /Type /Annot >> endobj 196 0 obj << /Rect [ 300.84 180.53999 313.38 388.92 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816266) /Type /Annot >> endobj 197 0 obj << /Rect [ 313.38 169.2 324.24001 230.16 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816266) /Type /Annot >> endobj 198 0 obj << /Rect [ 349.86 180.53999 362.34 388.92 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816302) /Type /Annot >> endobj 199 0 obj << /Rect [ 362.34 169.2 373.25999 321.89999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816302) /Type /Annot >> endobj 200 0 obj << /Rect [ 165.89999 581.75999 175.92 636.96001 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816327) /Type /Annot >> endobj 201 0 obj << /Rect [ 175.92 417.24001 186.89999 476.94 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816327) /Type /Annot >> endobj 202 0 obj << /Rect [ 220.92 541.62 230.88 627.72 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816401) /Type /Annot >> endobj 203 0 obj << /Rect [ 253.92 486.42 263.88 572.58 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816482) /Type /Annot >> endobj 204 0 obj << /Rect [ 267.36 428.58 279.84 636.96001 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816493) /Type /Annot >> endobj 205 0 obj << /Rect [ 279.84 417.24001 290.75999 478.2 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816493) /Type /Annot >> endobj 206 0 obj << /Rect [ 360.36 428.58 372.84 636.96001 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816636) /Type /Annot >> endobj 207 0 obj << /ColorSpace << /Cs6 1230 0 R >> /Font << /TT2 459 0 R /TT4 1246 0 R /TT6 400 0 R /TT8 403 0 R /F1 409 0 R /TT10 406 0 R >> /ProcSet [ /PDF /Text ] /ExtGState << /GS1 1251 0 R >> >> endobj 208 0 obj << /Length 3618 /Filter /FlateDecode >> stream HWr)L3?:8(v 0G\l ZW#ϔ'|p9=_ )ɥI fz#Yz{%Ŧ_* 3%dV #%,Ltfqu"[D L3iBU,a\_W"ȗ׿-ίbReE(3!$2g$xugE$. yj*B8JY^"UVǛ(TQy<+l)gRn)0Ɋ$f^ b!4L|V*,Yd4q/w_^~`=qYFIzۃ[$w.|%?B^iq7UFQsW!V8k;AK7JyowUkvC5 HQ) פ9 m/ppߵY;1[]n=/,dJX>)J%qavZM?V=f]TNi$Cl x8:kJV;et]]Y'Xue?]M#"(* 8:-'A hi50U !eRI6oK #4ܞ_2ԍ˕tsG{r#vz02\Sw;Oe`ВdհֆONorv50aeŐ=u2{8h2գxwbaDvdZv?\5|w oN I2B w!ضOaOoAH)k3z;2o#$`[ف}-$L~&$]n erӐS*KuyFXdNN S3Ԧl 70JY:~K-o ;Yh;Y$Vr {#ŒJл T g\@V fPIòz\Eo[HIn~BO&y5ji7hSmY s480J5E ?H0OySM!UJ/G_;~)u~PAȰjT' ehK^'%6DZQ`ڻGucR [,T&c(&CVw~> bem3Nofw`FړsW75&Q!["?s}M{\-KY`De|EWp◚_R+Q@ay\׌.!-!4<. 56.Ԋ{ XQNKN,_`RyxBeMB{zV;ٷ>]9qGɻ#!Hqj~ 16UfϽsdll/)*FfFL`6nU3u G;)*ei zvwzU:J>W6Zx1OT<xg7J 3g3c`gW],N3O{kqkCrtS+hMӹCe⯭K\ fv;Μ} 0 &c`XC/Pp=_d£cG ,NLxƕZ|ԣmJ zLԎ>TvXVQXg7Mqc\`S;TנކsWշ66@aj/|̇P__4w;(^Ȗ]H&%R)w|Mg[7|mj}bN)Ċ2P} CwRxu1H_TAW' rgA/fqpMi?7 7Ӹb`TVS˘b032ŢD6LjY99D.kΔ|LIXW<6!媀2Բwdムʿa1x0{㞑]v' ^o߾v7m~ZJ8mwwi~7[4swgg{=xGf77s, rB:.I;m#p)T]_`cb  pA6 I$jk2jsӥ:x`9&( 2k$JgNK:V)$ٲʅ[ ̸v0OXc<> ȭ/1a,y7 vY9Y,SϘEI޼z4|(9*G4hL3ﰂ$3ՠUc<(#8摃JJV;&iNルj9tfVSl X! [0dc ق Ĕms38keLʐmSf, 4). #H@MZ.Vgќp0@AB(( "fP>ՠ+gmׁ$\B:C^)o?1Ԭ0GuM[@<^먑7{3O|O<0%'(QhrDC>hmH澶@,7*HMzRe>ىmMPR+9 MN >wmk7p |Li7\'hЛzK0ƀc0Fڶ])a.?ķfS5?p*ΨuDe4QQ{S{}Q,i In-Bܮ˫f V (8b") endstream endobj 209 0 obj << /CropBox [ 51 98 561 694 ] /Annots [ 210 0 R 211 0 R ] /Parent 1194 0 R /Contents 213 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources 212 0 R /Type /Page >> endobj 210 0 obj << /Rect [ 250.98 349.02 258.48 385.92 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816154) /Type /Annot >> endobj 211 0 obj << /Rect [ 258.48 243.06 266.46001 287.58 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816154) /Type /Annot >> endobj 212 0 obj << /Shading << /Sh2 1254 0 R /Sh3 215 0 R /Sh4 217 0 R /Sh5 219 0 R /Sh6 221 0 R /Sh7 223 0 R /Sh8 225 0 R >> /ColorSpace << /Cs6 1230 0 R >> /Font << /TT2 459 0 R /TT4 1246 0 R /TT8 403 0 R /F2 412 0 R >> /ProcSet [ /PDF /Text ] /ExtGState << /GS1 1251 0 R /GS2 457 0 R >> >> endobj 213 0 obj << /Length 180689 /Filter /FlateDecode >> stream HWnF)4"lk{ 8kkLHLJ`c(jt]Wm׸y]b ^bhj#" W$>ww S]N U:~ǡ-g'buߩ`JN=윂^mc¬L%zO^v}ۇG3sMBڍd%k?>K=쪺r 0Ѯ#/@a+i4s$hJ1Ѳ%zp]"&ehC/O2w-lPqJ:EpZ ߉`4Vnt.=} "6>`PmW uV5m#WZ'REhQK2EIh 1cR"^]`RC[Dv -N4O mCrՕZ0+}sq 9DK5JsqT;dK也G2?JZu}XbPbe݂@Auk̽7킸g0cAFkRwe !PͲAvR8bY@&Wi4#!mYW0kw E:uzwHBxSlAzprR03 A6ɈXOA)vv?/`o)3jLsL!^]߆Cz&yJl}P&z嶄$tUrPM %\#o$\)wU%4IΒ7)FzL-U)/6h`z̈D2M9VMC9}A=Lw2ӄ&EmaxgmV[^:/ 1bkIرe $LN]R &!K,)1:dhzz#KNU5ѷ32ڟ?Ӌ[u!lY'c+.қx If ONԷ 3@z@uKuCTI gТ'BӪ[Wq*,\X @  ]I';M=y~:,Pb/xj['5#ky, j?(Ïf~>nG=䦞0ypmV;6I P˫F^"EAO/ǭjNxޝ.HzG@u}b3_;N"Ǝu_>6[d.g'̟YjزZ٤+T;fh uNjp׾bߥZ{`I(ku( n!?ʇvWc"Ϸ`Zj8uM} k*7=foC`mKF8u]p0Z^ij.֜1Ca赟JP䦤1IWR;[ܰobB%3Y@dE~\*d+DTo̻ % #V}\Ϋ;'/{%_6Z٦8{!Vy|M h4wyMz4*e$$:jKJ?c[9~tr9O]'ls`9 Aјp;SߘtZ\6TUV2qr/~۵cgȄ'm%R6"5x[40EÇG`Gz V^ıEJw8-Ȏ3@1wj]pc P'pХo%P *:˦kei ӑ2>HZnzIfC<͕}5Fv[ǖӄ^~u鸑?OoP_X=Us3RNkDVϑHDj=nd׻D 9CHz1b3e2KDŽv$+hs|2HZtɰg.˅ (b%"" =U'.ˆo}>!O ] x1jLqjB%&':7f&lp̴ώ c)l2.At wOP8S`Od6CKrj4ޟ#<"`ƇM,D}xB`R&DBdY<_kF` _<[{Մ%X}D ིzkF-I0\a"ܮ0B_&w,ֹMyEk5UBC[QR2C6c= .ebhKGAc1v7WSf 虜-JC1s\LB&AwJ% :<祅aE&Ļ%Ҧ`Y&aB'ΚO {=%ν /E-у,Mz`7d@g;#:EE^Bt~7qy۽p' %~;Ȃ<){%)D<@f%pBPIe*^or\Dbc9j\7\~ޑL7}Jur&sϼ?cS8Q3cߺŁ`Jg jl 8#~[.*ygb25 `촷d ɗ E>0y __YN_ 6Ili`X=x~ub9ǩ@޽Yo#/lBm Պg $0R( mx ^W+TD-C+Bd%xs<:,K` #`W֐_]+JtOP# 鎿agr#q8W䣭&3PH _i]HGV,(ÂrP PPYeHt:My*Nk!CJڍp].N>-90cY /Xڰ 秥.ؼL9B><6sʼn*"t5ǖOث%CiE!8vrhĂƹ]A_oƗ{TnImŊX 04PNBy zZh~CxW\tOSvkqR1>=onGJYp4$ }?Ǿwޑ|ouAQ%XZn1ȩ;, rrü^.IqR߷mx(:Wp״=V 0:<#k5q5ji%=hlqlXUe)稧CgJc>T0WX,#\mujΉE *;<[Z+htf)DSβwM)?O KOu6wھB*|hNTbcĺ.?Jqް$Z?0;U8<4 PK r0k0KBiodOҗ镈zҜb`Q'5AMp30Osk[XJ}oV=~^ᠾ{m9ψmM/ |;TxqVfڐNQ4;#@Ңr_k 7'u&ԀOe2kfsXQ)$@=ԝ:CywAr\s3cU`K3$|^cA{IqsTӰÍϞqgd(( 6v 7ȉwШx{AXf# ۉp_tgo,m &fQ >Px8ys:)Оlk:@Z|/tŚQ]g^]2-)/N?4Q*oE֍nwH@M^(E~h&jTx+(.Fps2Zk0rVZzJ+p"g Uiw lg6UW[G=nu,y^4ofX$+tBƠ%*,tF˸Q佣խJ<銓NZŹ3,ku8P*69낾gK=?-K)kL{J g< 693p;JbE-Q!E2A=-煅"bW:q+fX|_`ڐ&%2ؔ:aiJi-ܸQD3̨H"4,5uqz2*69N V80|*;˽ܲ_nx-T٠p J'̂l`.KműCD13׭սGn50$ K@#^/ŃY;zǁY׋Es‹&46 =ZE(K&bZ hQ`^Փt.fk`OL1TfCa~28SYD7k)[x"\`. kϔ? k\2"tW 9H8H|5H=_9YBfXj b[%aiixyO }ܫJe^1, h1xmÌK (8c9]ɒ_?PEö%Įł^(P Tc#_U'o8DalVyW'WreQCqڶ^M X& X}$hMXj#!չL@)ZENJco fބVki#Ƨhi\_a#JmX+H'pGYdRapm[]T#<Dٺ{.%HcĶ*yd[z;Pmfd_o꿜e`NIrƱU'(E$JTSA'ikd$.Nf0IfPNmI~~0 hXPwT0Ή|=22.ES4ƭ줵-g.ށbnOʪkwR LpHF؊!؂L,Is~B[#,q.ۺNKe:)=TpŨ^<=g i \24 /,>vXW\+2pUM[C-hzLͶ:@V#GHU]X&;:isq@.R=dbG,_i9nM)qaY(Ix !"kFGVyb&1wyү#_JǬ?!;;"j_yeːT- 3Ѩ3'4/ϲp툆aLmF)r"9VoA.2-(Uw */r!fi> +߾V{ $w$|fHePdE[׭g`L: `YF^xY"Tl58i@bj! *zAuy!CҔY^Pq d Aεbü]$]ZFzQ>.VA*8H)rjJפt_.kN>:GyKGW'ťX2aH2;W1l/#7GE˞:͐N/e˓eѸh!j7d+dM^6evT$X0LKoabUcI9DPeLncIEۈYUW$>܎;VvckMSBFiJ2lS$fgU lD?Frw}qxtV^Q4TneîzꙆ1%uki# w'{Z/JH oS, u}uA eꕲ DOU~-av 3Ij+4J&agRbQRةжH\Ɓtbl"ᩓq6d[ a7dA( }7_?T37d5Ltt0jC3::sn10f4v8+W K;vi0p2 7Ab0c>,ε@Y%^U6 JdΝ*òrPV™,Ky䦌y!j ŝ@+9@U% DaZCn! X6^/Ƞ֮ "{ {ݪ'w4h+9@.q94mP{t#1Բ煨MoU?,,zVjv0%ɩN+>P5x9sbI7[Hۍ4B:V$D\QYcgzΗNVae:t&B*xz^ṑK;DӇa+,W} W³,^Vb-ȤX[6/FFCk<EP] F5'riI%Z%2Gpqm.0I--!vaĬQc`ll){%sSo;0?2c1lgTd| vžөzHdObf޳黧 և‘ 6c5As[`8#,h.ݮYz*^YUR%S拠~Kh5-i–PU3ؓ ]& ~f#95"5~3ߙs2j [=S :5Tt:5($ENO=B.9OCf_2c4@o.sM{ri +94|6S=3X;|0R>-LҎ3:Q\d dvQ`vyMhų:W51?R`Bxяt=a M~):HZK^{~08nyVHNۮZö?Q{)i Kzoܵ&F|2f,tY'X/}X[qMG\=) h=`xCKS-i`_PeYF5D{1ZAgivt<*QeݦJd _ <;JMĘVY/p9šb:U2xK'J6:q= &1u!8Xg2E )QC5@qrmD ad3.$+!4=TG:'IHw>>!~!ijի!AC y1@Ґ$B"-ɡ?a"`a3K4^\?bMQUGXc{-͛撙*}0%6zuCyyPh_ߣִa:W9":x2'&h[˩{ze`OXg׉!_l!3||1zb22Q iǕ1$Sf( 2= q)|7=)8A'.)3c$.ϟC<uUh W_)ȜnX ׸Tq(ʄkVKĹoL"5퓮&ݘ܂Ƭԁ5c31Ђkݒ3,LlyqW+`D$fi=P\dB$6X I@s,~86`ab5s@0ORD֓PD٧٩?ґ4_̒z@ղ֫{D& !x._ۙlq1?*mm5#w-mbv 2.L>Z'1XձU9a\\+jψ`[=$48r1ԛ@mPR4̫7ReּCGLX8viDߘRF 7Cl}*uIs"[3y{lɘmƘ>Vw S]._`9匽H(Ͼ`tC}uhA&mcow-bAX5"5 (7P 4l xǵtfQե=wZ;NRI? I1-L=hxLGdo_^?>Jwp +gr+o)0ˊ@0r Z!3V,iUI;x2Kr?~s|bѴ`[@ۄiN #cG 4]|[-z̸V6 @0Ob֨}}0d”=Β[)7~T T3 2fq;aϋTf$'1` YSCȄQñۚ9VP0zk n, =/{ʬR_EPUgK4yaKt I.{OS?hP95rv-U)*N y`yS "'ا ! RSѧ!J1iic7a= ]>z[)>l`{iMc¨i.t\2\(a0R&x4Y۫Θa !.; ʩ!~jƝvj,jMMΧ,2y.3&妉?x?$K0C!^֭!PCCi94tIA\>o6Fhm,r5%gU3Ʋ_8W!: ϐo\!co;χxZV"oAw:qK-!3) Ch%h t:/[5}9:i̦FW xXofnNӒ 6bbvZ_}Y/O ω'||aOӼ / ^Kîa,~L-&\q'󫊃_^"|QPǻO :Xbuvy|!, >lQњ0NXW]/8`0#Μ J;YPVtad_= 2^ƢכCfp#]KQ" + ۪cl'%n?-%w,gUfZBX=JG@ܘ* m$}>X3gRƵm rj8i[e$da8x($aq~q w,zi9pj7^_ {yH/u}P pg@x]Lv1VC7fai~)rJ k;TCd媫{Ӡ1Ȧu6 X`nhhH

*}ý:U`vyc7>-GΧP+*+lA 7c7]Em/ˑa1x 3cqޙ>K āz \Qi@0:"Iܟ`Z_Gg6<ߙ(,ZMi%.L/ʇSǬ=" a0@|LcGAӿ1/s+y}Cz /gF?>"-BW:0#%b;%==x}J@\>L2jdc~ {oa ( H3S]!N1츅Q x M"yHI#hyN!B%ZgW 8w43Bf}ciMjkU-GYeOojLY6QBi*Ap (JAcRfuǻ(fffSgp'NQw NZ&aM|bQgVܘ5GPC1*i|iVɕ.nZ鬛9#Ou!.ZO< (GȎDUe f!$r/ΚxGta.Dsj'&19YA L4]2uge$kIbxT+shZ'ʑmQVW!!a=i~тL ׄ*!Đ$ijkd>lUD6Y7lu"sM$FOj H( M^N4"E$#`(0.8 "W2n 2 9Iʺ5JTC{ ĒțC7l 19)QEG G<pgO$hRy𕝔T/rdl ԻroԦQ/n}Gh`2s]-6*oMZJC"1t2ūQg[񐛭#}av4 ylՉ"y(Z?"gOM [='Gw805!'dFhkicr!{Hȫ"bܕ&Mn~ =6 ;֮dz8&3~oޅ'hPh}!j%%g9;]uU<m9',(ALJhV>{WqODڢ0|lN&.Z?Ak䌜A&4 ZĹQIy#M}„uh*OWoexxbϞc7N-hv Πok;rb q)6Dd^$7@Is$; %A)y`yϏ5`9Ŗ掓 :7A V }ܓcW(0lԕxЄVS!G`@2r7E?m70:/AW;[mxri/2rpDL:k(0e}E4 6IvWnX\*kK݆3ŭ\d%;3w;JV",̄_/^xW\6"?aK.D?S"p⦅[>3 KygsrU)y s[J8 ʴH7]i8ʳO()N!ʤjr W: ]JR=UM2qn¢ᐳ8i`&[槼VDt9 ø˃a_M`1!Hd_Qg8Py_0c?'5Bi;cS=y"o5xkj\oe6xS eÍ,Oֺi[O˞6?mS:BhtLٸҭD3^6ۚF?\(MXŁQ*&EYLkh*$)_QʣO? i9֮1lU`Ch9ydXԀ*%yQgj[L.Jĝ%7ͥ#$n1uT9x$S~н¢†LJ {s#8/DتT8 gR"g0Ǧ;xr=q+ً\"LdIdto.e 5>AҠU TqW]{Kv(.:8%SΛ ِ DETqa̮bxG \m{`2[Aҧsf+$ْ TCx+fplnBSZPʼnRW>8"k⏡X@όI6R3)l k 'h USsk{e7nMt&4S2"v|6]C܀;`<+Y~"g= \pus/4}4Gl6uPQ#$\M&MɃ聜O4j:<ρ;cL;0.ԍuz-}+j)g-kZU3M&0rp 2Y%'e¥93j>6aQMNi Il[•H_"k&bira\p$~myCF*^.yK-! ْ"YAsj{OʁLVtJG+6[s+bd2eE? (OgƁj:Q1mGym`Xo5DLfEѫQDjp|p *U鑎hq>Tt[!w:1YW"߲7eJQr5ʐB|cp2jZVBP:k:iԨaS2#tS~S~GUte6^ $` mL35]q50]];s^kʷtjDZkǁWV)RxbEIz܎D m}*V;$p}.gw$8=h+.\:2 Wg2 KF?nRXAI,(x"ٯ-@) ]>V}otrgR3&^, /73=̶9bVGARV:3|4df>ʼn>G?p(O_ʢh^GZUtma=WmjON;lR9rcC#Vٛ4͆#%bRXT; .f?ͮX &?v!eYq6خV~{/y =&Ϙ 5THMklqY1ݤ)IwL׏2Ѣ8]J # EҷQr_hzw'm6HiO3iLLGV3"Ynϟn m799u;9MԀ76d/=Ė}-U̇&+gNa\y6a`,;fco^BzYu@m:h^W[/L2Ue8ht#fr|)L&qaVGYٷEomo S@u]iڕђ R,[K@"ИCq6JFq/Q.<Bi \X͡hujo1.pxGι JVb BR=u^+;Z.Ňxs>Nyܷ(|Gxc7c#}C44~ӫ7lۍ཭ڽxpqy' ||AXJ;vpGn$Y> h۔? x"#()Zo8+VF(Dlݵ@'5drBj`8Ԟtg6Lo,k~+M/MSJ@[@طaRqj+[teFͩp2] uU/,͉Sq |K!Ir(m'nWs`*(d@ڨqAHT>P3.YQfX!Aq3z7`F"VX,Bշ.t5~AsVHeR^҆,b|wQ)%;KI gҺɳ3Q$ G_. ~bna]ӻ7^ȍmwǡ-y)"Wٴq$[H{@"|()sAgx=3wx'2-M-GBpl&=qI59n uGqQ>ږ{jڜ#ts~̙nwuVVK sʢ4N"kVQNa3Avˆm`K-.Ę7h GNqwp8?]]2cf{MҧBPۼ'GEXNeRy-gq,j$1tT. \6agtz䤢kEUr7^dJuڻka_lN@g*ҿh5]1M_(K|iԝiOBI5\,AWI`:FP.IPWGSQY!ugwDۣڪ{2QccSCk;C"Pg$8VV&k%&E_8%Fk#w1<+Q JvƝA爵N23:G%:mt.]D+&FUa>~>[;JzV&vldϺ9F9{# ss0ݠb%cǎsp#ܰC-rPc%w̽'̅_I17X*cw -TyU!ɩ.TavFUQх'txTd f'Ce>a2{27hz3V )׬W>cLtn ;"r PcgeQw٤3ړZ؍,3'GQ '"'du%7͹.Bd!9|{V|<;v DIlϝHjrvKvb>ch9!(9d4+ހ c۠:t: ;N(JzڢmބMK[Ia7X 9uQY6 ㎱;]-I pߧ8$~ۋ2)^Ϣz !LEN)J rxI)X tqOV+6rS4fZp0cU!N݌pX^p >Ibq8Y8+bՐRNnXV (Lf1xYr#P$bw3vUBȿ,AxH\`^v8VW"슫қw\3&`MH۹%lEsu ۫hud2eo[Q{WPO! .,VI %ȴǚ;b, !c \4&0mvĘT K-/^rQ̢d nd9I@)T]I-,8v3vRq Z $"<\%OI$#WE"񉍽Ѩ3s& Cc_~A`Fmh]39Pnz2_U3HRH'Kᮧ䃷z[%_ur JJJ'Hs r=l51IHXKHMΚCta2DX!}=UÆCu^.+~a\pCFCuBk ɯPrD HYGR(|$" tT yEzR6PamIUlD3H*J{i H?_uag9_~n<}> -*jW҂d,~xL{xHtsh2)m3'[_] o11vb^G2_u^ ώX2r3p{7rO>K/b}E+TlnwoUIJ%ܮ@\ J=ϋb9 e>]]jbW_5ad9q:xXi-bX ^6#bD<]ڙ#oark`[C=\;n h3_nqˢp⺊s%cRpKxx7]'^DDSNKzl Wrt&Vac 6.j5 z0aԄ7jb:{;q YX\ihG`“m.jlW56I*@61."tߨA'%[o}n ܜ=Wn,bnlwì.U/77tj׃;!&~!ǷzAg8LqFH>t\@mvUtupwOWщӣN1-]qL­8#Yr偆b}n97{EA\sF>7+[9=nbsFȑ =2Έt,`y8vй  X7pAL>Bq?Ou]n93NGq+9%U{pc;l4vӕ۵_&k" ЅU&/gdoW޷pį!UxH]+Ʀgyw̑}%xy)6|֡'L;k̥_{ES#KOc))1\x]5Y+Gؤ}q|W\'}0mW4+xZv;"r0@ryҟ+s :ǕbF!|q|Tc0Qwqu"A`cG"˒Sbf+] j|%歔%f)1ػ5y5WD\މxl}W}"m/"{PC~yjoϫr3[Jk,= 3"OY ǾK*[_RHVxMT8?y(p|}c\ƃ-KPւd<1IlK9WT&4UԐv*XqL+l̘ ?0smQ&$Km|H Yr>O/ƣ!vƒb:V`/L.-<*ÚbkO`rD-`k{9j[GTOC>6 #>K6#E~&?Iז gm"nPB?</3}qV^tW9m; kwox~RI?-c$}?ich_Z?xЩh5cwJDhLx-"lgE8ܙ[l(׉C[`JCgdF=(U ARAe&dx`&#eGf>2 UӫSPu|/zlx+ ~#ƐDPfN50(0mDNfz+lG*tv_Og'"ॳ=7QcF"㫑tҊn)weXDKPX04md}jTc#%$l/"1×?a]A]R~;>aKv0i}ԉ%|*ICC`I/sےb+=1hYd=P֩!pcH?kp i_N@4̺ܹ ;ߺ:~gzMۤ)YK}e3_ZG ]CLn\:n['9G&c@Ɵm}NXb%ƈxգv"ؚO%b4LGz+νO0!FO t |OK[y]R Թ<0߈5}Ǿg:F*znm̮v2U:vJ @ αc'1mtHZG/r/̍Bpd٩F' 85_z NVf3FIH;ʼ\p'N{ qRKRyD5?~vo6U¤3RK? "Xt ^4D~>Qxo=NJ ,Hm>HZL-X.6l{Olp216"|rˮ=$Z;G @g…(Fa\k }!eS1Hrc¡)5mSyR'2R.1ǂ&(;}L\e5㩠 ^FaM[ޜ*#"zxf6?/(K#ϠثvBgM BheMij܀@R8!N⠫ӰvP<Θ|ɂǹ:.LDkZMd酲%bD-bwB=xXj1}``<@= w>ؒ8O<# & b6̷ksB555y`;Kd\},Rv מLPEdAY({BfffvP @\yZDύ{wkAfTbC t,}VP% 3ngAm]ҋss1#M%3~!vas'oݩF+;wFxS+<+&]T;vӷl;0Bčz2'1 -=|}nX p?ARbZ bn.b溏Q+.! N?hO {۶Qma"X Cʟ`ɔ^vP. ~(&<)a 1#x=A;2? "Amg|f3 {Y@HcBqӾڶj5N_6јw*gY$kGx|4Ncjl|mNjM#֪rV_ ֪=]*W٬U\*gzj3Rٕ*hwtR#~ȱo;0 πP9+ZRBm֑T }jۋ";BR@xTGr(UqJU*3*~|';[#_,(Gq-g; Wu8N fn[JwGY1: JKB+"nƸak&Ѝ8)5ٶzM0N$-L6t ܢ9∫S[C/=|^OۮϣSS fЇ( ٳm,l׷ۀvP>ɘ`mklH^O1ϠXj|݆>00;PωVXB[YG=Q;Ugu?]_uR OC@}C(K!lu w۩=P]2,YP .Vl Bx;G`qT*a"2-F; ֺ} IżwZDpxs9!Pi_V_D`29"z<~>3,­Or7' cN轮 ь"ZmRµZ^ 0p۵=s#󑺜!t ڷz KXk@D~Y"3e.(躉CjZ3އ ܳohJʇ@ xKh_H<# 0#>]Amؿea|Q1/nvnkMY`_Èfk V-H(m}!Y8 3TxNkE<;E> "*Ee{|#haB\ 6e9uD}k֡ڜf?UUԿ/CJ з(͎n{|Li?PŷKGE/W R c_y`=t7~⃠M/# ~{qU o6&qV!9I1IgNyCK""g+Os-E $v*)GraA=3z;;@o#fy^юbA͐O?U-ˊö+xQiAXFy)n[tA*fK1H@ ȍsS Ek߰(TOl9h+!8YFM" `Cji>"!}pR Qz4 ډbصU fK۵_`q4"ƨ6/!^EhV-cL5 /[-o> "6ص7k[q%8!bu[/N_TF`4-xٱUl'NG8TgU!M7=J!k3dl5 ̆ #x*V߲e, qOI~Aۺ1ۯ}KxIR^ $lVH i|Bʴ!+J6$/2",ltT X\.q}[g4/m3J@*P$ZyuDwjIشq D^|@oUo8"'""bΉ 3kf$9c0'w6 1h 8@$,3TSSڐЮ-L+/$ߦHpU$ J *ǜԣ}jLحnTsJpT^\lq}T_W!vhejEH- tݤwaNqH^A/v 9}m)ˌHx=Ky/5? ʤ)#hrFc(gܢB¡ޢN9Λ}_Ub&G b&QԞP!`P-dfF 29ۑCsBU%آL2rC99VcϚ'LzUKnݑu x}}ǖuNymq/v+< C܂}J񔘯(eU/)yK-Y}" 1:%vRk="R6 J-0Nj-<5Z:fmJ3Li;%(l(EdGҒ/D^y앖|b+-3JKξJkra"Liw^Jk!^i7ڧ{T/baT䄈ڬ  ^)D> zkE}LI!65Mdɲ:;eJE(P$R$ɚeCw?AA%p2 R,ve̓.lm9,eC[!vdŭim{p\#'xnpsb&'@B(7^d熴<ol" D F/\/P-"\aiK״-cċ "(41"hOè0>qm}PQKTũ-n$@ٙ*x((gƋ%k k&s1pkcUlbG'֗>Ywl6eݵگ,ͷї]0b+˶IL]DǞIm͏*ۖR $Vvp}hJp{zY|n[~!Gu|*7{A}We*ʸ;h?W!2.K`pRD ;=Ӯ X=Kk5|Ym~][F ^'".\?kPbEmA0k%}=`  \m1!F`"kd0z}ʄd6& _dk% [%YucɊɶ#r# t4Q״n+Ȏ`}9ٱmˡڱ>\. Y/BѨ%0ddPDAOjg>q(,K:eBr2ZGΥI4ce3}jd dO5C~\02bA^[{Ī{^qcvKϥ0r,95Q mO;C =_UwΠQǘЎ=$!dؚ7 CX$仗ٻe(~L0l>v:iC$hLء3 Hsn?\z%ّ2:R1qX$"b6q#d϶=NV Ѣ4Ĵ#EHp{1j%a[ .j;$(*QPMIHZ$TDaՉy+晐a_?cy5*^Wjgt,.N ,y9ΘF/ˈլyDOf4 Xhl-[ =M=ތ2"Ⱦ^ig ( N^)&z>&/@21uP0 "YǠ#8ڬ/'yf}wx 1D}æ,dEa3REuGe>Ga KaZ]`GIlD>84AvaoEk;>"S^v gb?pI@/aTA;paatye#b^zj-%Kw>3ss%/63jyD#"hWdW/"h3Cxiӧףvk(},?q(Q7 jݽ#!BƋ8cD|2/ x[I݄Ƌ8v{A|[Z/iϵT/jwRdI2]$U9$1=O*c{xaN˘ _?fyD,+N]̩*^جq2FЬ$sK%0Vi#Qns˭!Nv)}쪊؃aF'c޼ͱAeOjPY)_*+QY_T{B*xhn5m<5MA}5Vީ|k1oUaUK!ʭhSc X"Xū2}`vkOBj֭JxxuRc}W *0KSg^ 弚؃ ".! ab{hV5 +l^e吶ߋpAmbun#ٖbh_ _v XF\*t2n""h#7ʏۅX^6Oow+E/={uLUXd SE Ն6dK%"MN,gqdF:NpzO&2WM<&=JyDp42"hW\1mAD>A۽x"hKa>f -ABCgd3mShy{-mQWB0Znw|)7&#pG"x`B9EEq ŢPe=־دWb~ ;Uځ'N9RŚ6?$AFd`wnm%v]q1ĽzDųSUz,,B 2#ZpYQؼWqVp>-IPoJ!>;/vIm>i$s3^xQ9}Beͷۮ.lѳ udfۣU*ӱlEЮ&H0$\}߄qK$amC٪ac m\sزS=7yA::5}Gc:LTzQ:5s<84[ЫxqkCV;s@W$ohᣆ]{.a=qNYˮza_r\w@4+x02b]@۾|T\#GXa*suiW">`Q!Qa+W rv%9z yl+W=s?3~_4k`|ߌ"y4g92c3*n1ƞx5yyl;xA 0C0 mUg[M]1MZ[ˏ߼g˞aʃPp01,eXhTdh 833x-$S%vvlaIp[ˢ;r1T@HmV]pflYSO׎C"@@9/j*CT72GV ^B.krEADt )'"hw+}Zpd }Ymc8QGp?'#'3|mBU؟ZضŐG>Rm_ŃMϝq^8ug TIعWg_ Odۆug?6-m A,_Y^:y#A{dPBg=2AH 0^ızRGGm&sˇKٗvݶK4k9BʵhBtq)qVg}FgicTXk_R]F lK_'̖2ހG^ݧRavVOZ8!o>aK{YCI$ͪH4\4.X^He<#`D7O"&LC{}N2EƐ#cǮ|mEiuΐvNfq`8{˒1|@LH!H2:e2%c"TK ,Dbpϛ:N2֘ɚ*֨ BwAvWw Cno(;+$m%~l2^(6dL7ߔ 7)1{$SDsK3v Wڍ3b}(- APh{=Wgmz:KWrH82΀KeKF2'O.raf7)PA!\wSs FrIbҐ,xTr`_tFW\*Ahz1{쾕aB7aF/@alc^#Wi9 q;r |#fGE? |&ѼrBT.ZAEѮEgZ8ST\0u8Wj8'mCLE3k#+!ȔZl菧l4Mx¨|$c!’6@ !rUT)@f(aMH1ЪJ2[fR趎TYST|treãFhS؃]fϪW[6Hm儏̴̢S -` ' s0JCXP 8N\7cl8UG, [q;+6a*~;"D  3&~el`Y Ըr?}w;m#2[ɠdN%ޚ{٣_ńy429KSq$ x}ϯx D ^#Q޸`YqZawP7lSE 0`Կd/?:hExD n@ Ս&ET ~ oE:ayV/ HÂgdKg[lo/kv"6{ퟬO_0kƨ뙞lN4,m1TS##Y2w>xX5wͬs<Vy30Nޯiq0}wͽV yH}79faS>F8z&3\"Lܴ٘"x M4&2c&n!qSQg@舰_p,JsA:θKr81&ϻSa̷}"b 6Lw/;$,rѭ |v1__kj^(dy&kN $'0C`*Y"f" I3b<^K8FHU~\w `4<))o";bVZ\_~n$|{e/t,y+bYˣ CF x(^QBc|uAm%Zk| }w ;3lBvL&HG 0C_6)-5ū!Pi/!r>)hgRˤ&p_.~ml`!_ׇkǡKlt`Xj[ ' +=8HHh EjSZu:K֛p0Mo?5,`ģBejGhE[E//z&dQ~!V0S."59|О>1ծ9jQœ8YWSz6Q@ gAug^@NrOҽB ڮziW=KjW==qJXsN:`PbSf  x%LL-7͋$RaLDWwf 9ry;$C HXYߊ63 `~ڼKv֣~؎KSSTqY8E;!|êؿT ҎKz3Z}q_EżiQ&%{}7=;[+O:芆5pgWsT e| P"aX6Ã]UXdU0'#5֜?I/y ܠ&b͢m4 8AlvFrM?-X>Qw9ء&iͦGR?߄k؋Θ9sϾ%7]O$GɃ͡phgB/LD2byg{izJ eī|QE4P }[/V8:& ,F_ڽ= y6+ /!xK8R%j\G4re{E;Z/Mlײ/\_# g떆3!n@t/NjNl>^5p2*snP0.[6ck΋Q/ևX$j6@x+)-ŵ왁0kCUoB4 )Z%>A W?]p'>qo)zA0W^ CA b\CU߾1 &>- 1&r=$U%!"yoA 1-Pd$d5-3/vǖ-2ˠW"c0q3< 8 !!b:O5/D0t=Շƃݦ o/!<^m&3F}DHL5I'F^DL,սaRC o{H l/Ͱ`N{Y'hZH3o sE6WsԦ-6]"be=n[:C(/8 }Q=gCi1C}0q WiyD@ġ^g(~7#>Lh@>yni|g/-6QmXMCpf_"7Spr)Rp0˓cv8@+F[ !ر,|aLF2OHά &8 5(`40QH\F+:ґN)7[8;# />09_lIE LMF@Gr5a]weW&&_̈́%Zt7;TI0سMTT+mّ"=.͍Hx1^[Ç_$m#:3>2uDkR 1T152z`-MnFc!N 8 B 4ܜ@Stz$m^!hEFчPl0ִch %Jn]ZcbR/ 6TBK/U?^i?~PlkirYcZӮd]YXc?ֿŘ#6 |@5[ͮ>"|ap5pj#+m"2J98$*d>&87Ozb9ϮR{f9;{NENՁ/.x]稖\A,jʘqmͳ!5~" F>rqM{DѴ`V&]n6Q)ڭV&.E  ěe1/qW6َ'Ȭ}&zTg{meus8(\SVJ3|n C욏Z o>Dc̗0!J 볓@TXͤvFXfhhqx9ڏZ=XᲜ݊2w3|[_P~[d-^:0X̋Ob2LfQ;9ݐhnֳܕ>$U92k}yY^Z5=2k?;&5Y ˬFߍyA7գ 'gY+$׺DY~'kkLx͒ A;>@Ehh 1Ix|"!'h\U'l8"lx:/{튇au!^)So-/0uG)7U~/" ;W1'ڎkuX+ +8,×x/ /(.I×}}v擬\aޖLw^OK߃'@6a3EGv_ _XQFTE|~J$TO xVs>"ʫ$WbPdA+-U=r`N-߫#uLǩFKH7F@aZ[!&IQj)q2iBQpOP.yb fB;, \;ĩe59+C/bq0Q@3хCSC{zu)D*Zܲm3tR}b根[ssȥ9ᒒD$N0Q>\ Hn )Gss+OZQskSAtu<\O4\ۭȼ4盘IAHNE/1"HC?S+[[cDPiʙ &^`_gty/a{Vl*V۴p<0[;D C c$WhsFl5t ADOa !Fq>@c_}f)CxvefC  UFi~ LBH5[*f5ef`ȹ8"zzy@UaJ5V6t<|Ǥ"m^ wqoC"ۤhOng#\aA [ҤO`ˇo|)"ߔjZ[*imQnF iчAt>z\^.j¬bsFZ56 MpO~3q'۷WvsZ(~6^n{.jٚv ĞL@N3s#;xlbl"h9.Xfl_/{ A[_A<q0(4ɶ@61̞睥vʜsFj{)Q\uVXK5cOk6?9n[/^ueU%qGNPf2`4ƍ& M #Kx˜KQ‘W,CEpT[EqԂć qU,ǏmQK|"g$< |eVOн¹O͈H .׉S;f rIS9ވd:-ص򪱕;s|?EaI#qIB)2M E~U#0 9&RpN=0ϒ8e}0 %x}W>!lQI/Ph@0NLh,pJ)lI NC:4XnWZx_]ROg] mW^)i^u}HXk5i#Nk %cB$U fl[v?7=zlkaU35vƽ猌Z#ёzFW65:04fc:GFc*ȈXV];& "fn!_2ö꾎S2#:j3-*U7V1!QƢ5ul QCXvbf@([.{ŝX% jK7QoZ 4qV+!k[fβJ Aܒ1edD.XG3mjCʦah2luߩl? Q01AHuE-A*x'ZfIlψc2Æ [bdı+c2512l+Ø51 a{}:0tae؁"F)edD,x5֤G3mJ.䇡 :% UrWkPr )9ּ㈇HEmcd&!D˝]W4P JZn2-GtRΙKJC8s_31NAT<3NAoB?o8b9km#4f㈌O٫%0<Ȯ=Ut/## ֻӕȾ"" ǶjhQ~MזgdıˈV} O_7^Fe#0jֶAnF%]BZ;Ö!6W眸Z{4@8@9/f6cԣ(#^ia{L_90_~yOtz?SJ@5dCM9q^Qf;ɖ/UɃ`yujvQSJ! Wxru"-OsB`񹶈gd3z+Ң\m^y\j(Wk\FF(W}cr˕ɕW(W.F9rEvEТ\53/\Q(rrvJX3@w|+!4XQs8aX]lQK+CTT+tyj:OhQ1o'^T+^Z&^.^ͨVpj;҂Z9}}+ؾn+]Meh3@c a{™"avo+2  sEB+fp|ʈ%zm`@4uzMU"㌡ @8#¤k("ZE/č q[CU+T-TȻ1l0>DpV%ǫ+t'y:4ٯ龟^8Sa^2Y{# |`*lGj:zNuc0F:=giA\~dNӦ49YNsjN=ެ}vٲYe{OyyC?6-AtمþtkK2'/E_@mv/wT^٦6y)s%( zm1̾>W ɈJ^*\MAv Ll7*2xZgD+mGJz{bSK6m>6>\&'Bn-ʩRW$Uï;S#274t @Nh.0Ȫ,˶XSܲ®ax=xs:wy?&c 7^t/R>SRaAdB }:{d-u<5qvQ,U/nF.k^tp[t>w3%턏ˀ7%Gu[ }Ʌ,o 0з7I/k`]dQڸ^³ /SFG+䨗 T{D%I5SOۥIv]vO莽=Myoڳ?Y$\wIA5Zl#A؈ԣw{O1h[+ITn1Dz/k$<'x\($ @\'$j'@lG#c4>CuSG\RNW9MȺ3+~o`]m*"?wIU">Q Cnd.٬7tU4`oCba-}khRMm[ǟaSBm0!,k@)GGs&+=|5F/CўVU i3Z验:,h&yWU}Y8hmIx߳%Ĩh|jH&7'r_ DN/lhKP_{guIXM`L4Bɲ܀e;c)9B}jIPt f`9hE )2C]N]]rEQ4 d/@Fgv^Kb<%u8q@2Ϻ 5AF Z6RO).`VTSAέKzhc.O&$vbNߝ nlG lkhރ;5'EjNRמv`[Y:R<22hG<N(,mK ivCbB}(剝ND$A#E((nV`YPX4ՖtGѠHB`o^nvin뇎FgXsd|2z̹J"ǻ0-f:u6 /_ro ^Ǿ"/QP-YK Қ$4ItNΑQ$7q7zG?>>ZMy 1g+frֽGgO8i_FtMwind eQ'A zRWP~>O 6 7s7uk+7>TRM5WzR>^in@A2䶝 5 (Z{X{ȸFx($WN 52K|]k- :u9Y $[wH%_p p -4ĥkF)eʌPGcQKBsR:JK2"+]'23/.AC':y>]vgE5ο; X2mZ4P䱋W)X|H_W@~7'$[p5t gH_@E7L=8{p\Wl`kon#|+Q+{EI5'LeB_}s).aȿ):ViH`'DEwS_A!f6HeO|49vkrY_DsF濊kgXX8Ƽ@@}"/onYKux5D:֤Ԋ [5K3^_CAyEq9-"!Ex38Q~ٯ,*a!_pWL~PdYgߚZdEGNՖE-NTpQm^T P9 L29-MDw\sXlmAqΈZ]RJJ+.OFMGR<>h^Lh`ha$#k@is?dĉ/S58kk8Oy99py2%hye VSYSh3Ԥ^j:3`RIa+oiiy ԳיePN|}ɸ |4VKA8fIFD+Xu?jS@>aᇇlPEQe5vUt^ v,_p*gaw@8'8&yA.V R \+wZzu'8';,{V⬈Řh/C&oY?,sro({D._0(Y Hn>u}^ֶm DA4 jk(-!(D);D,Bby9y1|:F*yĎݛO=wYB75=NAIG62-%A`Ɛ/\CLU^w+X4 b+/#{h癘S&T^npÇ_jU^CWuuh=5 L9qn)졸MbW> ſZa˷ vo=Mբo.y8&cZ[S%~eXxGZNӼhCvۄ= ,UdžۻΒ'+!9 c(`zFWPHɻ%=QQj[2]@x E\VDWq"޼0UW#OߌrzoL? q]ä́(_Xoc*SPěcyz%wn&2UhdJ-1^L) !Ab>+ m5fO\Y3f8ut7&U]$ø^([m;dk?CJ^S̉ynӲcfiH _8n1='_)acc3KZx~\loA 2kq#os6+$ȼr krHx͙($;7ef`̎euX9m k ebtG|}'f EtH],H;rqHP%Ct%AX)ӑ8S4uwt3n-\lu]Ilt"&E%Ū65}L'VMXRKC64TDEdqsuƜ3KOߍhb:EtTOA|jL){g5L o'cW\9BKl)s#!1g3KC:]5b )^T3}1a ᙏ3^UY&ܱL g]\+,NKW+!i%NsՁ1 :S溲^^Hqeie}-kc~unW'e;ٺY:>mp?'5p-zcti_uxVl ،!Cn0K*dr1LV`cږѾ8W0Z+ús V/76|Z8!RSm{b=p 9VfP7 -3-3l[ב:%ѱi2ɣA36kL,n5BR !cv8Ȁ/AbϨΨltDA`3G4Z.];Q Tk\Rs9Ȉ {gj_GMO;Iݕ$#&v^\!bT󐉗ŭߟ*3dXdfZha J&uI;}R Χ$.ƃ4";0⴮`̈댚"7;v]>[%&F&\d[VCV.)տo͍ayy8Lhh !8Ad]2h+EDlZLGx0G Z)([MW Rg$bS1Ϟy`M_{P ta9y0}'jЧ[(=:Rme %=MP3тȂ7WyiSN_[oi0d~~qxBԊ''kq-cM +`cǥHycZY]1Mkl~A,յCA /q^^q&azOE^#FxZ=!jQZP/ՒP}:Cv∞2Bhv*xBo'?НfQ_@N sSߔ|Mj*< N4- jZ ~a)Ոo"ca+|02jAL65ڮ8mkL8MHp-rW!šjCgm6s&i6ɶ܋0\]8VFȼg&-{ܓ -Ce,__%Q")qVcjm'//ivSd'd@CIzkGDL_=nUR<)5͓r;2t.an. Jx#)7YWS'b8rwrO`hœR]k'WLvQUyHfXW py $dXKg2 vM̛Z;I .]slKMwr:T#o[Nky/s9#+'WXf'Q4ٻ ݓwpF{Di 7pȱn}s&¦}&"3 ^WS3"9$=Cvm-3|Y:6QⓈ&meD sa`郤 ̞,DrQgJ8jFg&mVIyyEQq=7B4J(lKҲ6];l` `$ˈ!e)y$$:oI 5CAhf\AP[ޖ`-M2fT=0/ן=Dor+@`V;c4e M7ѯj,1-EoW}Mw qEi0 1C br`==wteTJeK YFµt؜1s7dS?h{"aԠ N  Xէ3]9 S-nG+&G_P5jZ5fp)Zk']CH v4ǔ@f}5U5قb8&01tg5 9\'ͮ@dh"@BdglqM }J ^z8 9Dkx͚a,&Gvz*SK(߮wޠF6]c Mi软M0Rfw%]a*^]!;FFa96qQI!er;8wDF\zqh5eJ/tscj~r39wu`t`@LfY#XXsu H0'9ƒLP2 sCf]#%*z/`š**wBYG«D{K%MJ(,G*xTn(BrH7\3H%o$p8ETXE)עa3Q듘b==*EN!R s\.2l̺>Oʱ{0뚐 =^#`'MD#%7IH25Us܃ L!'k"#=kb[=a듘1/o+ba $}x`NCF(ڱ X؈u$p~f}xRY-^:oba-r qοwUJg1E8{"8zA<q"MziQf 37T}2_V0$3ggv\7epc:ą'@~|YM%1vq!\M ďrb1<Mr, {f} ``9v<h[cmBkATUT:;m٤}c$J_p/>XSpu-n b[#qO&|} G x0tY9k_p`$zKAsM ónϒvޒ %Yw1}aUIś7<)5͓r;2t.an. Jx#)7YWS'b8rwrO`hœR]k'WLvQUyHfXW py $dXKg2 vM̛Z;I .]slKMwr:T#o[Nky/s9#+'WXf'Q4ٻ ݓwpF{Di 7pȱn}s&¦}&"3 ^WS3"9$=Cvm-3|Y:6QⓈ&meD sa`郤 ̞,DrQgJ8jFg&mVIyyEQq=7B4J(lKҲ6];l` `$ˈ!e)y$$:oI 5CAhf\AP[ޖ`-M2fT=0/ן=Dor+@`V;c4e M7ѯ]H44 0) " K #{sڟ$Q[Cg.`16دu_V^[rS;#w--zGbʾbA1 rïG)p&z0JXL Yƅkgҩas9gK}r;Ɠ.F -  ;plQ7'05?ZutðfEz})1q)9ZzĕvM&{dͶVO_}&'v"J MƶGd;6 Lfg“v}fz;ƕ@*U|$'?[le\jPODg8qf>ý)-;6Voq<\ᶀ;7rվqD9sư7p)L.`TGc"ƹܭJ&\"B㎝xaf8Ï+GGʦ'B iy2eUzW="s3;c]0F>иd;碨1#N+]-QY_:w=V7N7s2uz zH[sB[m9<8Wa}KxRlo|j2j LI/ݙB*.q_вb7W' ΃GK˓_tX ;&9NX;{UE W CLdeC-  98m ogfAʠבbBDVEUrGn hݙNŬqK\vmJG: _x#VNتY:V2%NYP:-Ax켖>pvadE=XJy# !.5a%*DU CO o )gG<p2(osEp\}~3P g?uܸ(ԪNG"ZX~jjͰl:~`j!S'iR؍,0jzd!NJ(ށ"L8|,XgdeO,lC1kݘE*3Om9ˡ:I.פJ~FdX6U<µ) !L O #_" 393Xgf2e3IyrMG^*GuHR~FFiD)K-LU4-{L+-kĈgaCpb fHd!Nӱdۥbmcx߷|~ M C+wt~7K5/keYeM؛# >xjz$Ӵ73E6M sWpmܳd3ob=SOrc>~}W?5Y ,UmMTk}^L}UrhK!Ido(wi<4P'5kt ߆[JVo&bv# 0Xt|@G%T1UR`Ìi/Ү³LOf;"8M^/"t]"x'R # A4Bp'xk}/c+e <-qe tRm"0Z[(p ";&ř[xn6zãT)i :aٚ2VqbFV,w}ɖu-V؈fzؖhT(˚BDz=]!Wc:xrEֿ"Ⱥ O􅚫j_,L_аM[mۄjމ/AeQg GC([Jj wnNn:|``}T\D B}6*b XcqGd QEPbc߹dN(6xVq,4)dx `BmL[X-WsB L#0:T4صblb0MOuJI1 CF_iQap BhQM +N-UC#|g]coDzɁ(3>c 12A#:QqHA@٫C> x B9eJ=eI,6βb4pM8Bՠ;NdqyS3Ԣ VL^=ĥ0 e2Vs"&AeYƼ@Y 6+LъmS MR3t#(=HD_"JcѪcVyk2E (Axɉ@Ik{3SbO&L9gط?eSSt[ǣ]. 8.9<9<[y.ڡ.֑2ƍܚ%v].Ip:{^BO=G yD}ܣ QR* '^=q3M;UWўBvɣ'ezjSJM}Q{;aW|A,OKlhJ`ۥt_.#E> ~&i1l"7oq$e#Y3IU+rVߝwXnkwEgŊrOI/mY먉:zY9dOC$0=7.;s9\ g:kYF"~+&#ruBN{~ :3&5/ʈ03-tA֖_-LX<T03(}6+cʭj܃R* qZX˞,Mo [wJE=.vi}8W&^-Ҩi. B=j~F(CIoO]Mk!lƒ/ UJgTvMHy&ǡ?Ve2p.{KS*;NaNC̚C2ʇ5L6l{V"qWi%FkMkvst1ld >o~Ƀk|(6;`G8(nۂ e0[ckkP@,o3V2@K U(a i5iQ`i{G>-_ia#Soa~VB㜑O,>;ZJ+{>3t;ܯ6kg!:D=^[v*Hh(;"afn|lDC-acfqQt(a@95^!I'GQA]Q+A|@֝oǭ_溎` sҙar Ji-e -WЄAQWṣF#c~oB&Ѥg\]+ɜQ}y.C`~ B`񢗹nᤡ2H  2REti Vc48`i%ˀ]IXLsOχLEG͒cv+X[Vɨ'OyI zGVOE.WhK-%ae~hU =YfR-8a*E-I!`"ʱkk8Q&\߽n=?[ki-|ul5Rup8 /f>kAmQ Xz"[ٽ9|>^i狼I"Au,}.z? l5緲VDB&֛g(.Jdh괬g%ntͷ󺾾B)5Ԗ mA3|)8=Np'Iu5=2RE?'R UR)x?`waS!#y@<,!$Şp X)R:'ݵG.nVEmy%U,6~xgxnZe۝4ϳj&bƬCc_4R>vOQ5t=63׉16sAufzWr*㔩հu1=ɭr6y( [}˺Bdͩ$zNfxBqgd%k ۸M^eĶE,RUvse 1C/F*_ΨuQ{S],4$ce6Z;L43mJ ݍG-[;>@8]m h2A>> x}!1HekGxp:}g׮@>KIx=CzX]keRe\;+eALs݈-쫴mўSX S܅$yͱNih,7M>ɾ⛰(i< c3Qm#e/~uu%K;XY)N<}:¹@pBVQ7ӂvUz`l , [rdc۟WCj_ 4Էl[=M r %%~ߺ%>nߐ9q2;|Z譈N΀KsiIvʛؒr`qǎ$0> kd,w YʞT&T5j8;-Rj/ ?j9a{콀gX06^ls`xM4& &=A0 ߨj2"uW0yt]kPƣ/I'hO`Ed dț]qt!7$]8P57;c 2"݆/qCRzȓ2E|_o:wUHc촀pl/@.ϞcEUh{3T7u7vT+8T)6,Aۑ ~1=nd ]r ae›q 3I{[@ l8}>K1&J8ZfWv9Q~@}F3دCCU>T #^?#f00Xkb'-6ֽQΰ rm~rHʹ7D1xi Pga l3~>7 }-ql ޭ:k3g}zcy(~:ГTU-M&h_$Icu (4j*F!$ANSzʋRm_ePollBv8Agx P q ?&9}j貈 #%A &yf[6nMF^J*jn~ o@+M4_B-+ƨWNlaffz"|LŌқ?W ?!2Z?{MJt8TR _u=X/֥aS"`Jbn4(MO2| oy7Y ;?kt.ЮM|T hOaxYzѧZ ZOS͇BdǭS9 X! XR]ްjF] 8Ih0UR8trr Fk뼤šL6ɮLD]v+qĖvl&¢EHu}L\ 36M+Lهw>nβKpFݱSY%v=0 n˿C#dUae~(MU$6؇͔U24w(zɿM{^zAEoDSCګP \+'>К#owvI[aԪgH 3d#fL[z])V;?i{q!#[و>yK/~ACs*/YܹrVQ'?03# b $mng!Y·)$elfmDt.9'Ի*},LCas=q/ I&Y_Λ6)3 >d<,E8j s@EJ*1v ^=oa^΍ kB-#JhbOū:+si+$)B6μdm/p&r}+l؛ԭ~7 M~7EAܹ?"CdZ, )!H`ƨ5jKc1.D[KNR1qg6W-8Whc\dM\v$ɖ}"O fݽAH(Va 8άʮ"MNY)Zi6]g{p-R=Mܒ8<b\SF(q2Reҏht\$I}@Gp:*IcOxᥫРN8+S'G^8T@eZP%[rțl@*w/E?!Ȃ(D4\17`jc,ĴVȳ9/!K(SV*U3`!'.Vv:!VSDX.#rIύ*Lx C_Fh ]Lk!4AQ^sP(~ !ҝx,t":*|쌴F ,CGT"'#9]-ɔ)jQH|Ӑ1\QύvI5}z;},?1!/OoH/2iO _绁M!_]x91rl4cvsR6"]UyH1d_U% 3Pm:px\w'4*%hD&H?uj_}Xnh0_ wF6"azs,J:M Ƕ! ?xVYnqsVKuʍ=yGES>`g:d~7Q 5woTrB<jPHڗse_D&g|veX_lÐE >&_cZVdeUDL1#veT .lreI}g6F%tQ?P^9d"ĸx5ԼB* mSQ75g_M{ p%p'2u.>WA??禽F蓬v@LP1"NYƬ Uu)n,Bf ?Rz_dlj W3 /+}hA4lGu<#H{mcbO\E5m {dר\ƤPUSdrO+Nl }05 f1Iªeh(\J} JsUbCVA5 -K/ VMI5R?%I"_Jw+ND43u,$k]lr<UoؕI@3+Хi.Kc< Pbi*>, `LZd5ttiڣ.K[.= hdlhҝ!;4y;4%vkx.M:Ӣ=sf"X<Wn9?eITCy&4@˩OӤZ1D|ԾؤjBm-eD\ӢWE-R-jͧG]Nw xdx-p0SM+&} 'p&n/+%?&N@^0ƿoAs|oÛfF[|k4pRX]q:cv\ Z܋1J0F,tCxk$ &q+lA`zH3-mlHk+Q 3P)aM'"rgQ1Z;~ d+u{/} >.scu1OF)W4>Ak;^#x[yGŗ->+.p՘#7oqY%jX(3;h\Js=. ^BeG|K>aEn㱐R>,ʠG[5c|,WzS{*} RRFRӊ*ʮpRNTn3* ︹ux4\j{,r9Qr|TNH%A UW5,~*[^U#ZFH|U79oFqְ coswOWpCO̓0p2ۦjYq{/>˃a_hpyO`, hpf3#X|j\Ea*Deޚ<@.3m"z4kŧƕs*K h]{-5\>KEg|VM+l1^ $z Sɹϰȓ`(l39MeHymEaY b%*Ks-B5|33V8#fTlycG5HbuJSSNA bte_“ԓMpa :wаB7tWەm)L#Kg<3G0B|usv*` [ }8{wBW #((j+Źad"D*LU Nn(@1!Ku&8}#X*hY0zQҠ-OD&'"# TбbKax*yVJ@@$'Lj)pm;gd}C/fK?2bngNVרpi@6MB5 !,lxQzm\zbGAyZkX9PI$>sjn$Ph"D॥QBu(dQpAgv ,6T{"4rN`*38HHq:ށPVx6"ɛ+jr:DuVE|`Ew0e ħ)@1 ,tzKP]baU&a(%ї-4sgx ٩kVC'gm2M$d j'kzfjSRY ;dS({Gv9o+X|kꜭ%R㍰23e woAc~d':ٹUD'@ζL5@u﬛E1|myv3nk" p˫*O:R11"(T2 7ϓBgq3X+P x[řN>63 Lwc F:]D)y +RUkzAAaA4</r/QռCGWAx^Ța!f9l~F#䒃om$dTb)-5֔%hx;$ ֈ>z:g@U0)S퇡f '<2Ւ~7,Tۊ꼱2~ݏ*"ESvrlod٣5Aȏ3KVkΓ=E~'UCV9w Bv2cg[8os?ƬOEs3pQӾi|t7eKkZGz7cTEgUp)$>2Tn(-;Bɯ'8G\R=/dq0ZCsđRY/']>\3`" '*Vwϛwσ6+{gs0y E|y?eq\yRz ٯ;bUœu4O}ʘh,a?=$jd \ + 02 ۩@TA,0~5l`H dAϬM"8al*9kvHN|ϲ"\47ڔ}~X٠JzL*,Uk0Cndӆ` *Ç\l'QP ,NA r8DCS~3E1ÂXt}^cDyM" hh(i#j۲CPiC(pkMDTg{4^ei״qS=e6߹GY`exPӴdcdB d|f(~Wdv$1')c ) we=<t63 '-*5*Jx)ցNID/I4"Dhñ,w/Hߣd" =ݖ@l`PE"Gɏp! |="DE&-v"2-Q-M7-& C&{Y!w~ %WA\yF fw'itF@B{@-;P{PEo**6 /o.,^AOߕ\݈={gu狈h-eZhj= FʴjңXx4ej2vY}NoaV\G w*I(a:E u[%c*Gr~1JU`\ 128v Ϥ+rk=!E rJ o@#pwfФulONH&'9|5OixK9cŷUR]k#,noCk S^[9fN{3m͎^;ʈ;mQ ~6OU3'V к/@3}9fV3h쳌JAFbgEv[%t"` Z֛uEPO[g:|`| O{}{OPu81' >{ ]^?-F"8Fzwio!yԽ|3zoӺwi;ʧ̗5LE$Gñ=ʧ^>}Ti[|'ui_U|ދi/|Ǹi}Q>wGti/oy\1V"T>9 ^T*@:OW+ؗM/^x8sz,EcPKJ7=7;ĵ+1JyDO= &UepF= D# RȜM;ۙ`]vxnXz4;/" m ʮ "f8hp6m1vZEfϢ~홡_ Rس5 Ṇje gey6^'k:ܼZv`ѓN qӃP *WӫF;麓&{:S% >#@ň͊R!{P R[kӌ{ZBiAp>Mf\%% N>k? 1NFByKpGOJ8Gvb '#H!-ơ C`-E|"h۞d-EB5x$GA{w)"w!`Plݲd<io1 H[@-|S!?t)ތzdy3scBS,a k$*sHh0FЍqSuArK$g&۶p)EB~{y$Y${IvCl}o NQg`SBgT}sv*A\qϰ9f߀c)Lzp*^ĵ(Bhr_ϔaۙH(zDeeL#gJ^ٵF^50@ghŋ?}5UFUjTL*sΐ؝V[Zt9?U#nXv-8g9׀h涂EFU4ANp<?۸?#PtkU(WQK) T\{HnC؂ QEYL ]qBQ\s!ڵO§$HV@΄ZT3gtGżۯ/:+ Z/*iÒ:|n#ua IRkR"A%# 0c#c%VԌي8wILg+y RT2b_*`p1BkIBﶵsn ;ѧ}.GUSy6\&)OպnF ةz1Zz0AX:~ٙ xbIg^dk#"ZWڃ@TJNٳ"e !ʡMÓˮGBDm/xO8=c<7$:=D L99!["*b`LYE/aӳ9ꊬv^5bu}7%huhٽi>VgdØe`0F~)u!?ZNUJ,ɩi^?)ŮՀ06+Acf$H$\n<1^{DwN\}"'Xl[^\'g5 2l"E?«%ٶS(R?Oڙ7%csNvy/ GeeL@bG ~GZX@_=˞# 532}~fNTT[1k f o Ӈvxd :pM8-j8AZ&ΤU03CF^ mzN LO <&"L`Dɨzpf0LxS55|$dl)&1(Ȭ\enwS_)GacBˊJg猀{$^ĵaXo}i%٥)b@v4̈́-ԺN &}`7[.w< `}dӽfR"G&A8߇g٨`Plk(o`t]xٙ_}lfOO8ӗ)@gGKӁG QF ;u'Ve5y:Nnj5c}{*277 FwL!> C`^0s>xUgDV:JWLo빢>ڂ=`6W57 Xs:.inX?3皝/9"} awPViГ(X>E%x;=8^tk7|=sk =Bq^$yoRjs+'a[0erYlB!V%O"pce CבyD$ɷ7Kku|z;߃`${ܫ5y綊"5KơL+M׬ 9Ûh6xg;lE8@qYx%[#3J7xN̾54őr)DJh=nI] h e<2i`'zU^^FMч2AJԭC"#Mc̯MQ)QT07B~tV9-`ڗ`Nn62^DXR:g܉Y]y:y} [{l{ߞlSgo=sm4 妝 3뜜w 9j 0.`PvU_cbyN}}9QZPx/F͈\yxOM|Kz"pf' Q Ώ6 4m;{2)][gk1FR oWt׫&^KUW^*e3D#[iD]J"Z+tk{8*u٬cՀ`ɅUuE (NzpSu0sNɪ+}oAFRB۽?EݥxkY,٣BfHp 8zC"^7ۘ?f c̻̼Kg$ yvO9+%`VE|KH3"b7d(U&%Hu X F;m]7.NR%E@z;0^miڃxOڴkZu݆H W[DKx$ٲ n7ѓ3Dx >nے(j9@V?Dա}H :IAh;3(E]WOz kT$PEt2>>& ziV`1nJi}o][.LZ홼s-؊n5FG=1:5 DLnh'24 +Jŧ.E51jf$gKb_ HhY-_rBB}A}$B({FfjԆГ.4tV}D;T?A2>>N''0 3 LVb10wiU*{aŁ"'7(`k4F 296d#C"SQ ^*;trV>ukg)m P߶E[CU-1^Zud&B_ vWVWش] =[{qsu/m`Q3~"~OqC֊S;>d?{O\H 9vpr)]C31$R,r:D-`W0~/Ct}Sf vfҀ4y4#ZD2}_;6|Y;ue-(l DqK ]g΢g3IvvPs pͶA [Ҿt&W4˂yMWgy?9s\&ZcrLͯPRT3X4ՈO)f)eN6LE~{Quʓ3$no{Pmo)=]'<vŠHAHƤ`[ӎ(iWlN.WTLKo'":!q \"%:!Wmѧ^(F~:$;#+u0)mP(^ >qbl4%KYʇw2&wkP]^+48{BE0˵?}oۤX3PK2{`+ coԁ_EPցj2N20m'FOʔ)|L7*sHTd*2_UEifUѾu!z<9o>rڔf?GpWG@ p!oN|h"~D<J&ON֐OR+%C>7f;/\h-EF ·W1yލQ{rNÇZl6SgD-520?1:N.^_{A m쓣]ei[ o %»lW׿e͟*f@EYM1C,2Or1|ψ.DKoxx^Tk?u3yn{vcwļ hFFFhϣœ8zc@aMT.5 gG{$_:u9w&QMDv߯ ϴz}Jf#>QO}ozbOY=LO5ص3tGF C|gv\yvv VGf$ ˫Kf̱bV<_On,$@;n6Vl3s `.`ٜo,ט6̀` GF.e1"?4N}8JfYh=#nth/V%hGF3}q y_B/= 6.9ڌmE4#~'1w`|U#aLK.E=32cP A`ҧ0ǎxe'PccEr @nwj(ʼn;bVmG0mF+0MP +!«K>ŜtǾU  hf܉PRy}K @SKX@#E/hŋ=0R̼_4**ϨʢQQ- ;2[WƝar 룘 d~k-VD`ћS=,$Z3(+r$pِZ\8Z8&?NMko_f~v>dQB,Bg+>+%\է/EL'7=RF»k"*'KS;Du9]mev  y0-EFqu;O* P9EnQo$g(iPT=^__1"(s4DF?d˛Nwz<5suLekxúhz+:kw74,˃:5hK%}zeM\4޽5oXkΎu΄Zv Wj΃ou \$?֬ϋrF ${@{`Ԥ/EeY1kE­5ZbqquAydϘ"+N2tCoc4ǃJR63V4#2{!xLw1˞4jr}NE_3[^9i \wrwR6Gʟl`gNwk"# T~* fvI!PkQJC,=zk93F~ D)Z6GDhK/jݴAȠ0;"Yc e~>fV!o7[lQd2N /b-0znWk. DY`ta3DPI42"N-0 ʼn;_/DKx8$"u%:6#.;r~_p/p'aCeFPyyF[AĚ!%0"f|Ew.D^7&$S-[WaȎ1Ɯgr 9'Gd_9M|)}(B}1^1F4́! #Dxڄb&-+uO&Î =G,$l|F`kyA),~DGbZ@)e;#-(>pVF:fy;:O F78⨩irEYcUjBxR҈A8R52vx-eak.s\_@)=eʂ?ٽjVkWfefw1?DHUp Yr*ώĆ:60-0l-E]̍zTf vuO>mˑ29_h٨IT[Pt3o86qnvZu":FcX=hb۔𶒭e(;Dȏ6d|qj.W^S~^n_ܠ`eDĕG`ܩXm[Њ &v]KGyEeo36|.>=8<"n? } ;?f>#Γl/z#S#oBIT!Q8ͮצ?_ū:W~K<㻕ͯ#<1`{tZe+*Z*"$, q$eq a2c!:^Y0YatДBϔ&%fWwSAbfujPOzJwvdlY 5WʩUn{$ Gt[؍ܐd~6( T0|&z|A\.>ilV hrH11ͩ=uzA |cM鑓d6lD#4׋( `-v/6XcuwÇ-dK֒HxGMW-=38|^Pf流s &km&Һz9]$C̤MF0-23WyF=if  aGxe[j${-jv8C٢_jm }Jdh^H@:BR"!j^Ƽ~ǘ=0"r2`(~`"j>VȤ_)8}٠ElލqEz`[ }Y}qaʸQ@;[vAsκ=SkB e@0\=W}J!χacaNzW麃.nRlN- wOz2G}33.F+ ? =? yDpM\~_/@~^m7W]8C^ƛcvl$xn܁ޟDRϦ/TzǫnMGKGCղ2( Y^1?`}U[!7hkxARݜCn?>cFB[&kN}fgUg|NDLX}gsYqek&a6LhcnvēOp@-\^ 2SH짧~'"&J"^ia38qcU}(PwڻX*aBd2% d8C3^čðP&<%I-'.)T̠')}r誵FE 5g$N4rqtw"752~{ɑQa(}2~'2YRKH&e jC.zL1A/0#?u7>2Kgi`vr.4s"<[b:'$9MV7X[m?*OaПY=$-MfXRBwp]K1F.(U vůڊfg`qsxȜXnZq6=cNUlXպ# /`#cDc]qOz"u-jj߷{bp(ԝL D܆yK8M4̫҃-ti&g˶4<*:(;i1 krB)4đKK?6?eL$ӷ'C@vY8v<+0Nqs}y3o0>cm^}[ƶ #R<62vBzٖE0^9_!1Eܸ/F-{5آ%ڢsXMQ2 *OQ124i*LefHu@hsjz@me UF 2>)&pdE0G| aLQYz~5Dզ|!GN8{jg'$guYLWgΥ /N;kJ*w *_,zYd %Ѡ8=0k6*qZ )Sjg2RNBٓXqMbYRR9Zq tNӡAy[휠cLW3qc"q/[ \Hj'uWgzn9ڱykr^uWL@LP2>rc|vns|%)Y_uu2!Z=pB.HoF7{}/}GsDO'O?^\|m% j$<Š1bFt./#-gE {crm|׉|x.KPS)oT}hPMz7C\-'cƵ]Y"L )j~ugJ`Rb{9}tC{:+^B%c0N}$?(k쌨FWeǎ54|G0MuOU;b6׵WKqQ, \3gxI6hV 6ٗM ;z&jEK76;pTt *[龐}Zɇ,0ǻ"{M*J|ml$URsb[waӂR}&ۋ+%WP+_񻎕xFڼ#DE 'v[0K Fv5>YP%V=!ˆDw0B$ޜC"d>Qm咽~޼W<|YeM'[vgx;9_w@-MṕRZTOO F^&"lWC{ƮTqO2*hA^ʰit`nEA@J! 1wvQ$RLvg>Fřri=2?) 7E$+v;&]+l5tQ6gYa'[B-YʴWbwϮĮ˜5Y^ɐz?}g+9Tvi>iJ,KU65tb}!"bgO+{릴x[ }!LeE-Gwx{S-vJ<>|W'"( fw)2ׇPU"J+`Ȟʐ] :!526vJ[1yE[;هCuʠs{tndkD@Lihm]o; QGc#9IZ\x?mc'#7Q Jo-; i{횭HKFϵ-mVإoǨ㵈!Xk=K z[g$bXt;F#i H\1 fF@51"]t{SJ?< XхW<`Ε?3i 8"zOg;_Icv-FBI@@= GD4};h>W3#AP2]2%,|YM!iw $ LaBv{]IBno3?Wgc˶3@ƈ#*p{ƜkdLie'f`:meN%xYgpkwwu \xSc(> ?E%DMNo9*gչn@|B&>qlB[BDDS-~0Pm$ A>?[ޏe>{ܜFD<{ C&.mwحUcۡ=G Dy;B/Ы$#ێd0 X}/M'F%cy*Q;G9#bF0h"gRWL:6\*L@lm\F5iV #jvYy=C| „:&@ i)@@$>dd6b:O:%>chy{L&kq\ҫ=3Ҝ^=h˳E}RgD(.Q^ӫ[Yy?vu@`e0`49!ʎ``I`n2cXjg# Ҧ Zw Y+Ӈ~zn#*K ',{m'DApYfb'#h'"',ˎ'*H# '.BnfӁYo8yˑYH@M!Y7h6 x'j#R Ep(sج6މ~ʎz oج yZZչc;N AO2XE;rRO;խ+v+jV<#X`Mz_sVA&<rT=H3yO"Vq]>]S}#Gذ]n' &Fg:v7S0>" X1I}">I5\3p; dueCgRM?GPe>'r2܁Ma+Tv29*7u#FhfgB3}dSxsOdd EGCZQנ8Xi4rG[8%[m6CiWϷE~>W%zrz}~&KN+W}'7=MUx̪ܚj ۽L^uT1[ElgY)K3tQe$VM3Lk/o?!qU[X⛘´BLvmfjSY ؖ"->z&w]ްEkv(ȯCA$,a1#o[5Ddig謪ke+Zxyʔ((TMnd"40Qaq-Sy 04 VX#xk&~>;mCIW ØW-LyrIRwND;@JSleXUZ^\e4 0 ],. $qiP2O;܆=U&o^wa9 LN}@KZD&sV4/+4 bj)c_y W "&X2@XfVB꣯x%Uõfftڜ Vw }MU51^a A3wnqİK@ X{sƊ2!Ψ }7 ;,M0xՌGvr +XJG}B U'vm ;`RQgn㍾<tm`u[Zd#y˔4?Np:8+ַny7m0:BӔui {_S y5J4X,G  T5x JFHG咶ȧ7Juh#Xgw͕V\ox!'/`,}wC*HklָH&,Q3GT,5>-cx7iM. *ƕ_0880` 6Z}9D~;Kfi  , fj N,U6{5)[,% FOL:e+N+ E0WZE̵Ў,5[/ W&%zwWLM7=hm-nz*F+pq؀4̍FKT(B%`m㢩j#ǙMWI`hez U{&̔^:oתugiV7uydxʭvrĒ^pʓKbp4]+!u QE &L 1>5=Ni:M#!D m Hظure9X%9Αf j\Kx,v)%tYCwľ4M6GSarUk-@('#Y޿373̻`w(rb%EOdV2F.p_uE#ptkX84ʗЍCljd7!0mQυb/ B(@~69miWzuIٮ r*ؘjD,h;9 3rvST햒veL<(5~ۯ72ٟ0ff/LoxhƨpԮM-fDg&ʥ{)慦,nFN& JCpݧ ly4kIneKYO{J [z^w:Wpۄ캽g@J'5#MR^fSmb4sVu z\z~0#8N/,5uX.߽A#/a,Fr@P⌏ AWnﱁRKfpBPېL:Fnc c B?8 ~TiDf*`s$_B,B-ty<,gnaCqff.b67CCAC+͘'Q*737q"~_̲Eϧ3k۸n:zo釿a/hqMQ8<\o"'MFt.M?pwm9'ˉv|?" K #!ɟ7 Ní)  }ʬKH8A.D8y 5_l%7hyp}RHkO۫lxXEiw2ML;u5 HH(UN/w>\!DUUQW+̝JXQ"(FBq'9y9f^ʿ]%I(p_&@ֵʬEAxx=4B.=hQp)OxJ$K#=<1 + Czu0oZխ8X?5i\C%?Ȝ L}np')g#&ɞj} eV/ߓ4 7P;>0d(3N:zSL&8P L#ԄO]S@N!ÎˢrOL^-S% JXleQ[^z;y1pQ{yY30/Ll:!35SrYy&;R?:Ֆy37^8=o\M/_'G.A,a ~a 0gT?gߘ˫\⮖~SEA wg $cs2ڕkh15*"%Q)q,cÈi1ja'gG2טtXŭ0]L e,cPƦev)cwKUUD^3:\)fQcZWYix1]“{V~1}ܳVr3:byE/tgCV_ \VxP+OW)sg0H_Ϡi׺!N-Aه4Oe"8#:+>{sя?zC{DΜ:egฯ1h=y^;߭d10'.iΰ&Ҷsw3@;N wI[߷UYYFtt7" Ӝ)AXCչ(ќ_Yvu֕U`TVf!恠laM1'=#5A3 zN^:ȕ'1Zչ+2` =i78oT1py1K҄@=z^ QyFq" ׈.괭)_\s XUèjF~HIb#p^i.?/yodj//Z/]y)TR4?1fl_3c5gT(H!;tpG_gsȴyϺeOjxt3}bLCR_L9r>1ˇWY`;a- lg( ,3Srspf8נ4bb 8,^(~%{G̒[NZ ) c1A-}Ḷ}\q=2EC&#B{LA' == tOx[e@Ӊw澘s[J3Y)GJf&C)'(\SjͧǸnz%09鎭,[u!Z@ɹ cʝ|! )(Źdd܂=bJJ9XFI9ƚQr):Bέ5g9'wI9ïQ {3%GNUHtcsFLE󠑫36709]*܌wCeM3J9]Đf.^rfzuH}y1rsS/L7QbUOZ )T]{q/ >gI.Ʒԅ篇/&2>_mz|zٱ7M1UĕVKQʊn\ˌ4Λ'$\cO6VT/l1.isdSԄ+mUL*dFTyƙ0|F!m=^lS z)Hd1/<#Lꬬ0AͱFXM]5PLMF:WY8?/ǖXǨ22.1,0e1f*e;XgLH#ĵUlldf4zBܙF:ӡHi@=֖Xo%hTZU۴t/:!c2S|hC| SÙ)KC#iLy^[@%x%Tѳ.~9i{SVtqdejɖ%a[y+`S=5d[#P)덍vƦOv$^1ŲT.'p3\}zMse+VO0c3ѰYP>$Os~+*%E-{KK4LNQn1T+42;Bm(*ӫǷK؝ &?h[! 1kI Ȼ= ۵ܵ%,kOzVcn-\FO)8J96!gYs _IGH #Ӡ"t5ˠfu s. 6ɭ[d -S \Q~m`/ca8%ef QW|~Bw)uzedNiC|݌_{V_H,Ōij:_L?`&(U6iiİQb6(MQ*s{(iK"QَOc6.+K+{+{j QEyg2?WMEwWڕǗ]fw@dj5&C".^ l"+ݗO0c3jxO_Q70YCW3շeyrLςܴNPo&\K5ө{x7.y4:&Wf=| iE*-^z;bYͅVޣédv7w\Td 4SW xDsTl>' ܀&z'&"WlF Q掴չyepU p|JWb_)L|FshqѸS1<p6n LQ vW_zoLK)t }q1.5xܾa}Q+Ь)ՐeQco/\թ '9]Ypɡ_Nowd>ar >Zμve&zMٌy9+a2TO.&N42oӾ T5HCnVUc~"[aĘg0 1. ; (˨ce#]VSW+LA,=mK {wJi@Z&_H+2 Nv+Z-꺅B/;m7x*54$w/6%|[mR"bpccnAfYN_&\la3TcnNCn앇2Wy/tPg½Qys*Ẻ6G肚64X"Q{xfLKI _j%߄}uh73璵`fDeS2P?d۟jc7 cg3iK.bJ=MufCvc[@VP'ŬzT@kF$ I<2>NX/"T af6Rm%Z8Z:==My+A"f;QǾz)䁬КY 'MNr-ЦaI٣1CVqe8yC脒Y51G$-֚cNHOH% 8{ yʊUp`AiA fi)Vxc~3s*LΜEh4XU`4uXLbɥ:sbOJ(-PULj}FD-U8e#J9)gd&D0Rp̢ I#=eJrvI)GjprTߴÀmA2荊c0LQ{8a=h k ]jK!%)?tN̚./fLQƤ8ńG/rS|ZpYpΗsPjp{pۭ  =Cg1haoXvx}-|^92lhaihŸ0Jr%G̿[,^k#(uU(g#R_@ESaQuF}b3/GW~] xLE.XWcwSSptf|g2Z]}a37_´p?^l`^,ʦ˞^çbK ٯ\ٯȵxCѺos(ıjoWZލZL|D -`m#)L!9#X3b* {VR#H0[.yԂY"%]&L*nEo&uYf{}n9F(b,o{4t7&יŨ|5%1٣g_-$LiD>{EAY{b9p"p@0f`7?,'rrR9J{:pxdh?\β&q~%R⛇?^}⌹D_#IO}cJ=WԠdPE솤h%CJ_+)io əֲW2W#SLo%Y^iu\e 9ߌdcy90?MqA{x_!+)\x =#Hxv=|ōLw8]=yM|vO4mX[X|1L;'*37PSMr˦pQwd;!i|7/-ȭ 2Zh>&D$6}!v@+Ԛ^nxok1>B_;(d\d'/?IfQ\8sJ̝qqPg7/-.cn-H71%դTl͘mB2 >)=xYFE`)˃RE& |͗VzNð[S$俶t?W Y&}.u5dzBig %-KW˺Șr[vRiXoLqI>UqJdckbo|hɟ[aS]sj-"wA ̀iPL'm֭ϩ~Y‰5Yq1H]q{HU S+K<sM&Nƥz*aÉLL6ՒQhKx~b_:}[5=lȴ.ZXٙ_(Z4cT2=p@ 6&3`n,s Fu-25U-\TG\v܃~3CBewhn[(zIq\' WI8CH!\yAt< CQF ] B*fQ~equoaPbI-4[yH_t=KF& *U;V]"B]Ř ٘Ƥf&r3F}aoI<= &Im$L%b#C+:'19o ǙO%B ir[ ~8ٴ<\~d8pʖ_d[ ! x,g%P;3 @#%>=bG: =LFk2Z+]\Otw gy_'jO 2&&,͘ e&felQ fl;0yJȎߘR$dOG" kj/OWL%}o(pwJ-N9\:j~ ҥu]1pm >D iPL2fo致[;JeJV O?-:Z]߷m4=Tke 'Kv$ ᙮ZkǩfpS|ϏY=8)_9xFl˜ yt鑂G };;2ReV2t6:8 ^olq[qxEw|zc#;h}&,v{h7#(334nH]U2^3= a1+U727G/FEuQu~]{bbjV+w3ŸPDl1` dh=d|(ɗacxad4 5k%_dn`FeXJBYDBt\1Pm$jCky Z(1V~%{ rkZԗ PpC kPsFÎr0@۝U+.q5,%|cʡT6u+! =Nh+b`6Ε-d|ѧ& 6`0,=FѱU Y*ψ[02ժvl>jC2psy/jǓfka]4 )LFԏ|;A%8Y r9#l=p?sj;m/:='a~_+/edN-cASdV_\ geKWϯ*b@.yŹeϣpZxo2~h!]وqy`K4]ðT]up`pOuԯ& KK[wc`7 |.PY7L#<:YA),L#,CS.U[tԜJ BRPLgXmm@`廷Iiq9 ,%9 5-u?$Mo"~EU&5̳֮;)X@sո5 +|9[-T~/oD[ ZL^EfebMTzz13"n԰fShfGNa3ťr)km:iVx΀Ka"3</zDR&v+(w[ nN}ו|Ս8K ɸ\nwҿ6Aǭ75 <w /g[{TRU-xA=knI?\!E5El!aHD^֒gD-jni9,#ư̬/3gs?6͈/Ҵ{`䛛eƄO[{{?>g̛ ^ <לo}i{zwofܡڿKbLjHt6'l_ =Xh佄aSSpT"S$v YNl"+T c`p`?S_̈́uRQ2jv`-Xf^V]%ٮ0p+@޹$#I?*UNR82e JɁ524IzUL,T8&?hq󌜠ѪVv $-pga4Y^l^Nf꾾p [)y,Ӑ`n[Vy>ֳ) y gFN31AQ|RS:t 3q[w&-6%QEQuưSWՆh[ Zǩ\- QaSi52{r\ jN[yRaz^*}cv ɭ`@5ѿwBIVzgّWV29=a^M@֢uowSckpGq _1!8o|e-qO]E[B&e|mrX)b͊bEY3!\BlBx#sҢ3]Fw@s0grHE!\ >ڟv[-%f)׉\mڂSkjm^j;vNzrCvxuZӝ1_j֝:i9q+Rkkթ[aV[CVj ҪHwZN\@-6hѰ dzNNͣ0KST6쬌?'Rց?tOߝ!F(.dj"w@L<ޡ&|L[%}3d+df+<`vyjI cF3{F@ǡ g 1X13M=Bd[N5&!3y3dpU9f=>$4Im#h |o,j4eĉ_|_zٺ c&5$qځ2'}a++;{Ëd>X1ń'ZvK2ݥVST!4Fp|yM4Mޢġ bvzp4G&ȻC:B.63?U*N` 4œX:֥IU #F6+?bCF*ֹn1xԞ7 QZ@l33 ߰;<`2Rb>A,Iz`B!JϒZyag5p Un_BQZRP8S*h{kC+ǻ,6L9EQن7b_\"\%9< wCU+l V mfG+Ơ"H4`;LVz U,L3rïg-QLӒ2;m ùwjwj#y*fyj}n>˞K'Dw~}eyj`qjApB9hn{l5J akߌa; йIC 6k]ybmD^6X:<_h 5,2FUL#|@t. z۳f6h}s= 'nx;Ju*E͘05[ WzV^O ZbtKPy=s7Z",;.- w]wOgBM!Ln7]cHPpFI;m2F =8{򝦉z|-L8nIia^ нM2IlC8#$[poN;i<S١&4s'>nf/Rvg]p -i[^fk1bcSSm;βhe7=5X)v,irY8b&VY+e;83@p zզŌ/FF^"!U[k% JU$b0 WHt+_E"H KòG.&4kYScTQp|dA Qؽ+cDLN un1Һ+5_ǘrTLCS~W7e2Ha7-:&lב)Cվ ba{s=`=JdYqU]@Á>{F=rҋ `)}hBvK`tஆfEK[_+AV:Lt gh[տ=0qAc^ }x3|-fK|N.*s;}`K|pMbIaUp4u=Qpg=n1R»ej̟zw ݍ[o#vaN !~`lsuLaU;mwIH6R(lr]qݽt^k3ѦCj)X3Ō݅-u*wWLw7} tΚ ,Ls* q7c1w}F_̂7Q3W5c2/Jwf`e5EfUzz$/ӜP~XCx䧽 Fװa0܌zKX pPpj_ ~3 &e~$᧾-Ql1-|Ҳd,= 1^i'{^ u Np̈́tEnkdu i8=~uai1s`t;^%=mo|8ss޵$4M|@R T޳AM9"[X.6ʘݑ& j,s&,L<OuY"1[ vs3S+Dݿ X73}q<jv_mqeb;X4:3j> ^}ߞ7=dLbqocJU{YS_/cRS4,­ݪ0T?ֺU;kCajVv8-ch/Ă"E8!,sGcނPVv?-kPJI֚vp EJvfPLru/̰qbuqZsWr2dsՎx2 cYfH.H9t}a U]M#ʮc+r끜00l%S(, _XoY"2bS7)ΨDM vXo'&nM 7T?L[*(7I \4?XexWcό5VpbR>15w'\Ⱦ s"ԍK&շ&4`Z pBFt#d7W1^/ 9!P-"@d՜~15x 19܅XGnF7cpwEzYRHLKMt hƫ*(OIxh#`,*Ɵ$f3d/kQ)j ͪfOzct&o ύ%Uj>ɕ1=]XT`s| 쁍-JK:a" Qʟ&OT$DŽ\&{W?'tc̘g \ЙU\=0킨'|I R%1Ԝ0͌+r+ 7 wb bnƴӼnv̔/!N12b:tQ3z(Jgma}Չ>;4e/i8d~0 &wyI'oLK)[S< p'} *@k.CP]H`3.0rb/\ f*)uMxqUSLLɱe|'$1 %7&F(l=^N',&I2_"SO0i5i^>lyoRFa6Nqci)øO<9èR)ɷOëGfw1IFwFl.S" eLV_2 (5]J3<>f>-a"ߘ_8׶2TS|14Oΰxpj ֑U}z4>i=%zҴtA%f<4ͮ !NL/ldIʑam??[nE#bY3ʘ1{*<$ˡ^%/>Z97}EP`*3BCB߰odP~#|clondRx -y+,HkeSf<4 &+9,a.5~ca] ygqU'bju+#XQt 6-aU(*XÆZ8h(Ck 0* Yԏ5RL$ǜ:+$c:rit9N!rT H$UmJ܏O #L|e0yvF[?yMÎsVأ9˜FX2aOr>K0Ğ+YvX aӮxihd3,`hWi R q*,?|)A.m#-2k+iIpoVĝA-Mc6Ԓ*w'y^ɜ]2ބDQc@C;'K04RlhFLD&UDaPM iv>UoώeVh8s ĥ^m']|!=9Nt(pT -']A[N,c{ʘPLpqALbw8tBX5ܼ v5*X%'X!urb Sǧ.*STlfBnxVHLV@eJؾ b  eF(5uօ8cR b1W>j+sjͻьkԬٻ|cUʀǧqvCeЉ+-%.dT榷 Ll_чV,$Z,?|[.=66FsX򐕰Pnv/q.!q&acca8=cTq q.qwN7UhR~p0㔭ŒS\ YЍݚZGq. u/2:4b&k<=hֲ)8!kfpVMDg~;c6f2_MOGܰNfu?O'&OfbnݘuYwG5$w|3aIu.ɴldjz`,~Yp L%g⹦:zY'GsF˞=e2oO)IY)#X HmOhjLU7VDfXQ$ʚ6=R`æ.duj*y.Wr]nջ1*Edsr +Ed?Ȭ.DeVkUNB*T/kzTf}rnV Vf^)!gU{WhD P;D_Lu+kř(3+j jzX>XAe֠cpA2ߊKh1lQKʼnu22_aU~U?5gMNGzW$ȫk6`uB5d |` wԵߘ~1riO`ؼaHx kasp–Q Vğa@.fLff{(M 0|nSxzZ?o@2á)Yh _t " SEHߣF[ ^r\]-_l#7'^}nT0<) &wB5*Ê)@#4.#)ľØ5 bPFw N[bPЮGX46 ![4 A $|ϓÃԥߒ0G'oqyv' u7Jܞk;aTM|8]1q-X JhS ;X"8KHDUXB-e (tiOr;pgQ"c'V%b8ӽKd3Vklɕ1vt>{XΙ X:]8_YL답pD{HcQOLjƸٿ vGf)CfjqFBV.aq-l^aUɢRW`nk)}rrj,vz 殟$K*#OϠ-}tXTPi0]y`p L(G3ޭgg$eSϙO==б^f|\:#5.~ ׾1w5p?Zًl@e)Ԍ FCC G jPM={̙3$-|p%z (Wԉ+t-&9ܽɱ54vLsʉ\2)7sqǜT0:0hT4f ';lĕNdlfwP/" 3 4-̋$(OU47֣Gt!Lэ/HT@pɊ|FfX{qbu*t3TgaOue:U0:n}Bh%O%5V')1<$uޢF< SFI2{6Ir%¾Ո[ {{zu!ZKjf~%ݕf˸gKgN 5ft1g1Zĥ\7nÅ31/Ŵ1?~ČIhGWB`L!0 YN)dfNBL#5DߦOV?"bu|Xbo5v.%űI\Y#Sa)('puTџW\1sl!$*,&V6Ū0.}mqlȇ |1# 2 # 765wKbbHV~3zqB0+n^qk3s)iY4Yo_Lɞ˃?27QɜLC,TmyW8S/ -d@'H"f0S3DW ݛM Ʋi,XWP% Ļ]1]OM:Nd|5qw #{r`\RXǀZTfAb 3 G/jނ|] >n`a J 4Ev0~0S3g./-Z1s oa[j~ַY? 8 >jÔ>QUELNbMvH);<ֈ+#U.'ݜZNgq嬱$cȆbb7f'EJCʛENU3mRs'0s +J1 DU ©)$9]8šӍI rN{­9p ݮm`o8aNXa|bdws|ZAm0+cɰh;uA թꔨ_w!k 9X$x:BXa5<r,LoS)/_Sec}@"+˄tt,jn^]+T4kJ,ɇ`^CKn+H/2U5v@-؜Oiƨzb ?hvpb3C¯sSÖm\b&I;hSl7pW%eUOa>769[zG,qEq@e*tӗKJdل k(ݚ1(e8`19;{!Дq{i}1yh1+<ܵ^/CC;'ПMϠ|Y +QjP>0K8aη'RlLөvh Ư3  zq5A^z~l )8hZTW@I_a_~ْVQ t54~-blm5 7g]5Ժ,IVa142Π{(>ΝAY`XQ$ԍ4x$6<8gC[B>8U-bNv6aABT/UcqCWpf(pn1c6 Z/Q"',3Αes}8uh nDUhK"&I% !dGKȆ<_~]A"p-U {8XЎO6."OʖSJwKeuԡGwQH{:'h~4wa~ъ$4 !(i;E*y[3?Be8oۂ@c3!]4#T{ eGW HZ,Sz"vpTӇ2b Bc =hm4@dm´lm<<;d7 [  =`xhCNT~NdzM(?ֻ\cjH مn9o<5mpbCꭈ=7bDK8=)='l /Mv# xϽB7 +|َnHJ*B\,`1'd@1+* 2a@6cpBnD;Tl\H_tu k"9 ݧ< 9j+J$?;ɱ`CJѶ\*^9D"kq!֛Sj-&BEI1<=x*s zaa_hn [v]d {s(z΍Fa?(=plϘ<H)X1tJFƺIs/Usx9%j*6T[+=m^0s"a^UFUu7bht5.㚉w>rjƳEh-4 ZP!dΦZWKӮj5)O>ŤeE A4xl7x 6ߊ9wsvTòPTVKhJ-EX*4!QP[%.Mqd H{--Vn+Z=⁷ւ=⋜O#x+p߷yL68@HMS7H* ݞlF{ЩFdo*er! XZ 퉩X^,U &UUV' ˌ2.:{۳g]˶̽VP|66gYu>Pn|:uQ-s|'!/9SZiq.<ޱ.^"=D5bXKB#&8L4wU3$H0j<<'a翇3L{zltTl-r{b*&|gr;WmhX+-Wx2 e>O ZCL꡷q ݀_dkc^VN82=5]"ymDiOGj/Нt?*Kqp+(˱4Yp6J|U;\ּ9hK biX@H1Q"J6D,MTVk֓ܞ!1ZC\?0Eǚ:Y'>]yޠ]+w_O]ӖBE9P i74AԥFOMo5eVR-rBv}Ġ=dM%.R^!(`%v3%JpaO[+% ,zw F š8qwD1N$8nAIAqv 8T6]mIpph SDpr,b9Vn9t{-h+:ϓ-+b&alOW8WOϊ2+jBO6YKD3wRz ?b[h;f548aL~ ! Җj"ٵ|mJY~1LY<Ҁ#JwSC9.Iٞ"ׂ1~5>T}~iDPFDte="vk[rk1f^x=YN<8bx 9+VӾl --@1yz=6 X YEbibQ6VځzӎF$Hκ =,-HBšzYf;yb\q#aDIFO>۱8(-vؙ'_wOŧH^FQh%s_\Өzf4ؔ%[$5n%=^1.]?ϯ'8H~&`_5:nTh>DG@Ԙ8b3#m{;w )cQ1g,_zgOB iCvjFu%jpQ3Cݯ:P/+Ւ#Yn}x$G{o?/܀T{YcԢ@DQdDP1] IW(( Nb(&4@HY ,~| `O9 %KЗZc`niޱ" uh'|ciGЩ|kQ @T.}c "o$~!"5o_I{o|B6L.A|S3[E[F0 ޷J`-G< Jf(E#lg _:2m/3Ml;7:h{\r%Jt;D%z‚ZT==ec_ZTƭ9=Ȣ^@+Wu ;-Vπ# |SYMFjZ{Q=X3YAshz  {g\.v6̓\尖]7:gyxBPJٛ a9شXƕ A0t@>ٓk@QYV:R-قNH ?փ:!>u3Ցy'7Sve>,4TE hxl{zvзj#EP 1ޤ[.^.LZ2UXg-4p_xf\&ALf; aO*'.Oa~s(Rģ=s؂ߝ3WYO~ͥ[|t^ʋwNaA 3SjS˔L҅oVR-u0X͗riM,@/od쑍a6ҡ%ʗtRh49& cUN]=5_f jl $Fou[)c˗W"!l92ejY/G\C-y%lׂ7]&dwC'f,^%a>gi{Y|W8 r5}U%|ܬYLxJ.qvSp|642Z}joX>Ҩ 2rg" 3LNJ< '}}K :f@lǚL0_5~sRga$]-6H}hz邆-JR*Rcp' )߷NN tGHSSUMɲ3S'T ~-O|޳Xf0UjJ?' weYr@WQ[AU׊Ye"iv'Ԗn]sx6<6a g095{ p͜RCo8#7TQ(\}~>AymB) ſ˩djOi; mOemTRx\Hh 0-PJyŮ_pd|2ٓцjX6މI((ٹ`D5 F)F3Z|BMV_/0,XKq*2cyq)(%1%=xynަ<;ےs|D;z+y.4g%S0񄵊MEه]!,Pv;؝:5zQBl4B nBwk›a=Btf)sPi-ד\~^V@lVtײ=DM+~K_CI6Q?[#J8I8VǷ|ϸϏʿV9: _M"c hhL4rX@oT/=|7T%J8bh6qd_QMyj5s]kyi]kF2kxxkvYokyEM@D;_! &_oڱs!*ymnzϗo~~ˍnP$#x' Čs,£fx[`&qpr8I~`]GGГꑗׯ&mu̧0V{O`P;QR_ҤžӱyP .@wi+T[ c__b*2 }SQ*ʐkv\l8,L |+`,Kh5UpU̴='ӫ`3B'X^mzŵ+-5Lӫ05N Bl^&:8C!~pILy ք_ױdw1tD%=^@CXfP0Ew +'0=ۛE([E5H8:nWggkbИro&Wn5sjϢ1ZA"gf7Pb@a@"ZJXg'8Ҹ8ݚHLUsfIdxs5דS|璳YsWoLGҌH꧜@MH2<7 rԘ1eyac'XU *o+AnER8YͿ1X'^zqyCE ŕe ?|h0ro55vNdZfO`j^+ =L-d+K%MsLƨʦܡ. SJ\^ Y)_L)IG:/qⱤ虛qnŔNˬ|@8Xjl?3t3k:$OpOz[ܭޖ1xiD囇{1ga6p.̓.ƾUBPD"v*ĽэigcM gyyeԅkij%neOXȩ+3ie b6FL[L^SZ`>dbJRv -"!\:ØQϱvc6AEKd962̏y MejN~۽mM{7&'X ;i oon荁4`ZmYs獁 a'EEn죍ߪ6< PΣPDB%Tד);]xCUA~ Upn6MqɴƌbvGՐDx6]w9.p.399& l.,c> ۨvm*^r]XW}!g{E~-wy9-[[yۣ|֫y{=#W%F%/,Ꟈ694ĉWaqfc5NɄ8)G 8 IN>cvI&'$s⒌{H2!Hc޸1`cn$ 8U9azrl~ B{ /Mi_zjo rz2s#+dXf#oLE4o ^0@X:B;Z"f_DvrS}2N12EfJ75vF7ZƤ{(P_| FˌckSHxV3Z7b dFKtֽ2֌637F{F E3W(:Ҽȴ̔(7ǤX<|B e~A .TGsv5PsWOL>/ |O3B|h7W5{p7;s#5m718Z?d yWP"~s#^j'QȬ Eʑ<\[C˧-1rztWwI1'Ul= 2ShRGA%WȇkW='UI 'G~ n_; &IV{:R6 d6ͺo%]6PW}d.yBP Y8P ;Qe F8[yNtWI@,zCԏ|N JCS.c@O+ou k_I13x'@zna'As)UkY-&Ynh-,L82eMt^A,EPeW文Ff+VN6{eI:bCPl(+@# ǕM֓p JurOꦒYp[f[0> K̓%6Y)( Ý z2X+NLd@:N @.$zH5 |Xh"v^IDk|Pa4?e!Y|iAdžm#}K%;[(Q'q#&qȖed6 \<[u" \]\RVxgoW.R|\z#u g$#(^$ם8b tzŖ} ]ξm^_/ @"~ۅ .0֩}#/zIpr+Q.["gǡ ?G`5EOJgɭ;tzY-S/ޗe֨ h,c*J&Kԝ wBͷq^ݪ@7qTo\؄Q`mԥA@v$ǚkE ̕KjQзX;#ɥ#(HF*&rF(}4)b1wnO 'dz+>vhh1w%\d` P}Qw]W@FQ㋯uz<8"Z ]E3t7r0 _rg%ju+v^XP>s #ah  89:A ,Yи4+r1> Pwk"!5%f𝴠k d@?I7;wXZPԤH/oX$K,y4[q g? nVVZF dǾ?:|uAvlfK`dQx/dsCP+({eukw4 ;9d Zva}/oEOk݅-;RƩ7?7Q`jɿjYk+Ac9dX9hʖ/H RvcS5@w]ߘa]-!c/$DM#w0zM )xiܥRS<(ρ&Jך&VEbG[~LĽS%͉5,n<ܯtxd:ޏ˜1f̷V{\M?F&ʳ)# t+rs}~^ǑD;4=B]z̤u_֚s4n ;wX{8썱fZF h=IFgv>H JL&^7qm/}e;M/#tq?UdM '(8OL̢1" f2)q_vz3Qd {||cj5*k5aVV `z|C9szgsd}2m/1N9z~x #;҃*aȏHy-c9肝Кz/@ʫ%[Kyg T)d]1eTFY16q0мt J|!w]'fcGU|N b>|bYNAcR[|4"޻Fcs+Lfa=0,1Bn Gj3YQ+D5LMZӬ 77ʱbINuhmJ.)<'yF05:LZ6ʛ)/ŠDȌXCvM-pH\H3lB +LV׉K)6_h$V!֚Spm wV Z:QiS'A߂QXrhEptx}Ѻ4Ҡ(EAv]'Ʉ + %Bve_7̋z6ࣵ-[Nx\ oi!Kxne[!qEFy!j)uKk88r +RI'YOS 5tW-goUs*9n_pD-8Veuo5LᛪGY 1GPzuk9” MǂWS8R=asA-Մ+ lI.awK= V9y=1a \Da3j 1nd[i.LfHgT70Ҋq_̉'<oʍ'VT>A .w6#~!1ظBWB6zf?NfyU Pfsr;Y}m+_ jxRO|}rGa.mEvlՏoG3b{cOW`DE#[}MeRlAmP~ZB aAM)00Ɵ`NQ5j]Rfe)t½'Jo͢r$XV\* *4z*Y@dhT$4~v(bWi#(}3,; kDTZ FZ蠾Gϣ]2֝8(2>I7R'æɈY`C=O9AJC2ћŠ))37ۅINUۀ#k@8i7d=WJ$g)4s<=;d4 Is/5d5drDzI]c߹p/_+ }B4uj=ر-kl m7ojiS]"/L%=`L~cM:RHö6ߓ\N>;ѫ# 5䍙6V>3}tIlGQ2+Yv˔~{џIn?EK͸3 m%԰u Su {W9 <8kN>92R&.圅S %[71<5 ?Ւ,W4v#~'|pܒh {A!a77l3K۩YXkGk:ɳAnFrs E JjEhEӅWYy_p_uV}#Ef=&GĘ]0igY&a^ob}2SCbEp!}Fʢ_hQ9o4}jQb+{*_X>srƔb8{U4/f$FQƼYG"} p]$9n|K Ŭ1rj]ⶱv>P09}9URrq0SBY^Rf5lW 7ճzZp%$2%Bc͠%,L8] q$SGSG)w>1Z4 ;N`9z /hlUO<@Ūss=LPG$,j,C~1>eJˣ̓eTNUUe 2F.6 ~53PwcgڻEI8BpU:|=瓁j/ _܁¹\?iaun 0C4ve L^rvn49C-7rAV4q[#1'ˎ W>{L>[))VCӈ~PST^[9j4Y'VdaC0N;&?L 0-ӎ>Slfl%g*mޱUs?O|fL>a`l#MpwS7{7ʨf(z4%9* }b%0Mq ճIUfr3p 5c %9`dr&k8VP;H5"aa O ׉c2NHRhՙ6Qa*]1b]ZU#^U A4n/mFoLKvZ7qNn3%t13LDs0;iPpW'L#e! 8AHf`ݑ=wUSLkMٱh !A>0qʙ*kL)gG osacH،CQ#:O RJ0gJ?z|91G4s7eR:Y\P˖9{8)2z 'F S%'$ߘC>tfĂe^3pL)ڥrDjUęz^ C"!A*Wr3>ޞqyimH,K770}o  s .u˓׹/ aEV4O&)Sc7tX|&XNABkx.Y ƘGnRc+%: Od^eTX]ABo`AP4\gnTzAZKuQ j^'*͌Sb?ܩjp- 'vyN r,o_iiL N/l̲ cMFABBz_.;hk{у՘bԽ1Ջ:ɋ'Y4Lf =q1[t)O6gEzaB6%P'޴z9{Ӛ㣎E^ޭ.G˟Gjr,\A+@鎿[B3p@[ntZQjnXkUk/(nE$$W 9%d{hW)=b),sxi[F*X]vKHS8A 6YC>~+*UC.a` XquXZ`٭xNG$,VBshFW힘x=쑦DmTqM+3yWf?ݡwO8Ѡc6,qyrIW^ek~e84,nYXK{Pq=i5tjn1=.bCm$aSGiS o?FOEd|-!#, ׎eYv'PuA)(S~]gs\[8S8?U-K*z%oT=ZŬ;AD  ȟk<*;ck Q]"®k/a>!-<s'ΌixF-jM8uah5K8.;>/<_[{!%< ~ Ü;1XL/ )um v§`pdLGϖ'@x쐁wF,c ]+QTnQ}av>޾ʇYq9%;oS\Qs1y˿`iXH]|dJ?K7gz=u_5~eW+^^d @* :'cG0MkWZbM74ޯdž.s!r @Њ =+G\ӑfGrvdEb<ڑR VCHc%Lc,m,\1vv˰wKRvi.Sc{C ŒD:̴Ą[a?gCWmNF%< )'A9*pŧ s |boJR>npWx |/P-ۈ <>./Y)Wpeė'C`d r(<OfO'[ʨF|u,x3_KsiS9Q&ўO koV\}ɘ'hsNV\Whך7Sjc'vV#W_LR\ˬ|pZ6f630FOP_TaEk=`x̶Bwp#'~V~*Bpӌy8Lvl򽖰LӉ\zDt5X4i*8T#x^/ӳDb_!L%p\>3V3LjB5=1s댟N<ΰov5hJ)<8M;g4m\{Ea}3>7O'b3U@ cя2PV~q(e}n3A7&NXj&td"`JZr [96z\!qb0{:iHp3l\#8h֎9b4Q?BWmQrrPj!Lf{۪tg4tm'PCzXHd1#l[vr2a;af==Oc^̬g:tlը ͎,ƴʡ}c7 wۺ&{2$k'ibfƊZ5gSX5f\$JƸqzΣ*d2WU?UE}5 t\8dϒcSјGA1aA Jxtt|Tu\,gdV"k8hy>YQA/1R}HXQm@qF7j PS{aZa~%CMߘKf&I&=cv&;U 弈oLL7~1#Rxy>Gb-3Q{^Ʋ'9v}f2;ͰU05+eiIԵL3 FoĚ1;%#Ѿ73'NWtnF=|2?lYBp4R{(`*֪mź2w?[1Ai#›wӤRz̦Ȇ`j(^1lɒTu_$Lz DF|qVݰ-W*yaJS;_ z3c3ݛiE.=Qەofex3ˋ˯VkB3QFXhdS CԠg 6>)F$mwʀSb챚UÖ"VX&O)L"6),6NZ~A^'QTK'?v1&HiXΝCO#˱8FVdMنp;b0Hb0Q.ly)NJ6P뜲fDE-:i>uyn|B`^ ~. 3 _9,xם۸dڍ6+vVwZ%Dͬlnٜ]3Aۂ).U #0=tgZ p%o@ D-ıbewQs`$NX>HճT*Z6jAٍƥbSvIm+mw?'9gFFR)}8{#s5F׽Ob:Jpzw?N{g!( g 8FR(iE'-@ %sיG+c &Py+20WCþ0fl;0cvR7!7`tsRWu.BFmuimoZS?3]4DaUtwC:.9WQ}}hF7Oz&.E& l>_(;3z6)Ӷ w>UOmUZ>rq9^c~= *M'>r1^+,N1#&f :?ƛjB}&BPdUd :_Ko`]`^ϯ+gjzmE7fAIH]#veUjgdYtt?t_ qtガkԑX` 5mר!:7DwKdϓ=v],\`ǏA E13%8A; 36X+ 8F0dH"ld.ǙxvxsH6^ֵ֦!? e0bN;p/yM=AĵFHHh[$K ̍DPݣ.9ZBQTTQ[U6m:WN8d:F64H"6{t9(CQI2j&gq${1I@׃.Hpa{QW&9owPsVjW )1\p$T.{K\(d3!/%nҝe>>.>} d->:#e 8m%FH}FJ} icP}^!m\㾠"a$KH*'w?Sߚzs{siX*ɩBV!TWXs$6UB:TR޲:yoZB$I&+N2mv@r<7<;t9HOskY8\I9)J@"A<yA*4(dvBbSK` )c>n߶o?mkƁ#KRc&PdJ*|^Og.i4{< 11jN 3)H2NԻjȞ 8#=ggpUsy#3'P[g ϩq2wz~Ff==xɻ*{Fmmم(q4pم>8}q0 41Dt3"g`&.> s5² #'Mh*u0sE1X9"{F>w@X8xV-Z8f sRs1XHsrI ϩ+ 9"O iʞyWϩ.O_oa?=ˍ"D3 "ZZ?TMܟ#IM#ŊP{o}#ayl_UUٮRhK5WxRnz мݺ7ڍ*` %ɑu!̖NH!G*R*7eNp23n(+QLr1L"5Τ܎͖NL=*?Dʐ;Y[דZ9݀s@/FN}×?6|a>I ]Ioۧ ߾ׯ_H+7f_;2=C El<%u{kom-k /?;9za 9tNBjH{2U)d㖍Rc뜠rbb z:˾hg{됗Qutf0CBS.zB5!R 7'X.B#!?n!4%G3k(10FW,a8,{޷IKL,t]V`[e'En] gL0sl6vn43J~41}a~=;C0Eg$CW9hd67:fp y_w4ip陓ÐzWcu/h+a3'ÎX-*+0tGѠ$!Kz/ޏی rcS8|(.n&,1h{v;,:*;vtV v5!K0f[qGcYfm |2Ch؎ r擱+aV)Ӟ-j) Rd8f' Qb,/HQNrfLA "jڔ҆ic+x\p@3JC1j45TKgBbS2Ie2ZDRHMc0dUg]p1z,|f=T6$ CraiӞ,6 }( udEIhI-[?+,E'ArtWm +x\5 ]~M7[B^IHB|ۖ0˄aZfz7KC$͇gJ.=˞^t%\ɯ K3XN#\2l$u=ZBjBWtzPF?c 9>ߜɜe3p )\AѨs 8+ 5f-pz! ̘VdTZ,5۵Ԡm oό >c:q &0h p+MbQԩXïe 9Zk)=yvիԃl(ONeyX3;81?ZA*Eyc=_@<Y0 V]CHc+V#m+-Nfᒲ}LԗLXIEEݼtTA-yv~L+Sgc r΢DBꗢg^&P3gsq c Z@5+&$Oo5څ]~=ڴ8)̾^s{pw̺&W18 Pj4` lz@kv̵+Zd+z3hffvq+yj%h +A'gXf(A;%-=쀪XjW3'tbIJCg;ugdʷ [p`7Zw3jmoPZaԣT@.<g`Ib͜it9B7~a)gpNӪb1zɯmw0MS BVP|`] ʦ+-]|CCf=[b\}Va%e wU|tC,cV<,+1S26TV#emU2K=,Ef c1:>Xmq2emv6{yxfe 93Պ{ PJƅ]@ iX#c$8f# >м(fEܫ PXրwG5[w=9f|n/pd*nN7yIet-и=e68xj31wTMV5(${a:@m%lX"Yh >XIM~}zh[ݕZjPH@gƠ@65f-pza)v+Q=k5|ձ,A .ZĿo& ͠Uc$(n~S셣FBS [> (8w8UݧK^{Fd`-2@h[ȊOQwY[:#8sVy~oW>|%zj-͙ rECG5[u׭h =1+lÇJ2%^ UdT](6M Hvf-wz`F.Z|5'3P FTKoҜJ2(¶Ht| /d|~oIQQ7_:\L+RĘQWaE05 /CLH "& &j5D 7a3LԌ/ 3QS&^f+ j#̩da,"*zj^/ 3QS/k\ǥaqaf@KLx(}R@L\et"y(ծ#VXqi#h-)2y%3Qd05mKLdz&j̗8\uA??~O|dl$i/h(?:Q Bo`X] f4뾄'Sc s Gx\)y4|CSi kd3p@"v,^ u?ٻe]u\ًV`7PAl.fɈʭanɅWr\1m wƉO;f͛M7SNׇ%O T4dI E14lº0BEaWec- ղqNٴ] CWxp ӼoL\jS8}K&Z7f _E̪ᆹ m 2Uqp^ !=;C^/({աG3 ]F0,HlYkhC!VK1g0eC`A 6#HMܢgI+211~ne\Q9G`%B#750턽_as`{Ll?8u 2s=հۙФe*6;ϱШ.{ǫê> dbW<'f>|gMaՐm&+*axJUS|ƈ}d@@J\U,˕T}И"9!b q$G ^C3xS ؀5c4bהHD5NG$Q;;Xʘk)u!L ]ԯjڣ%0_ۮb\\ھ2Ս6,Ά`+5=fݍԃ"٘FMxr)GJKx)1bXCk-(s-ᒍ{hZhÖC ;l['qhXyG[SfJLBv0]_)Y]8LF̓0.p5:Sěj~u띴+>p /{ؘ`m52nnsgwU[x[p'ÔO.Ɂ\))e 6|,Q)סF4hef\Sf6S H_cv}` (k4YM\65k(mxg}?akܖOvcK5WP;

T ik\ TUCk̽~>;*׾锥x f֑3sTtb'h0N v>dqMy͜.f~zr|A7·d O}݋.;ԭ{`p?*>~?:- ` |`8+?R0f~~y>9 _G]ʙNK #|3JM[BO\};їua7 ԍ/ֵHڊKgNIZ3 P)`սz^&LK'S$0K}D.L묦q-..Zb/Z-0ATe\SsH'x{gzM2 ;sD8mٗҞ 2%ѝ12Iؙ+RAc<|>މ\[L'| +|nK0?OeVfLI#"gɌ7cfoپ̮ݞZYm>ω^]fzu+a\]&x4}Γ%j mTA9itq%-_Iv|AcPW*M,̥t#-ljBcI޵Ƈ.&OIL%x~ cV1nTxYO>9mT@ؑ uBUAN}E;s=C5s.st-ަ;bs1Q2qnWPN|0J{,g7h?-1-u4T;/iBi;vLKcZQ` Z { Lm-B^닺C7q)A'9o1|kbnZAjg1aS-6rs b붡#⽟*k\f^9 s:[\}l191zgSFtԌA[}5Lr^40?O1/?|O" f `TA#%Ys6!,Җվaip}2.]0ChbޮkMFno[rxdf*|=‚oh*rdX/{ы0 :M17hIxƯ~?03X]kc!U|HU)}_?<~?*ݴ޻-lQm T mK"1/3}He4I}ܸ)j#9\glv=}ʓ'M>*F-]:ج,V~4dQFR ,CE*!{>~ymE9/EI{t3`_Y`}*RyQtLksl?@o3~N>D0$|ܻ@=V{{ ۉlSXnR櫷;m-i>M v~,+>L ef][r:fLӎ}1f+VȉM\ŃeO0&-ayn6-2ݴt"JK*` ⷄh({>jKc8!^y%]ob!s SxޖڅQ,\.]J7pEb%Vxx^ͦE>IJ.質\"@li/<ܩk~{@yr-a%g}cfql2?% NQ<[ăiK lI \M;Y7;_ﱠ7Iŗ}^e` { ^UM1B:cͦ\kj/R wI vuln^Z [Ky*#ݯ{>o0e8%c=9,C`vՐF)q˅K~Epum?C`^ӊm`eUfkhaZׅy6&wnq]S=q0ח{9MV`q!S%-&Gd`L1s cZom93Aӯv0}?^_r6y9y1m.܀.a&Qy*%6yFu.WfZC/S_zzU atZ#{aZ;x)Z./ñ kpX`.>4>_A$}hBNBXsp1 J!Us5Jt6Q0|ϱڵ#Yn`롯5|ac =?K)GO&Ѭ}<3ddR̳I^vSЂ)eȌIFqئ`yèsd4/"'xf-iKdp>=Ì<|}O iU9hZ3̓eW=giI,3]Pm`}5'S_T檿Nk&gPaxRFp.gDrtcV]5* l':cWX k½|zE ډ ?xJ'40}ﱌ/6&/n48C1P0j7"a(sր'zqS}0!g&|F{&KܞK*w:tbI[7="BDh*ӂִ.,A=ˆVB +JPMgl(ךI6)wM1eP ci6HjW#tikY[ŴFIj#2oL&L\U" YZsw K X4-a7F{G1=tcݼ>0GHΗ ǫaSQ[>+6e0ww?&xA5AR&8J|u܇}>Ύ1iqئϷ_pҟN~2vtaidZveLWA OIX"''|]Ń]ݧkhQ門/yx`:=ՎN<J碵GԚ\"PD؊ST)`K(n\Bao JHlW[R$u3*ĩ;nQ)oץG) ZT pP [buj_RSTym-*%%"4Hebu"Dv,'4;xawi_: Mx7.c {OTiі6h"ˠAвe.YF^m\q0vo\~%W.?o vY&wc} d^&4*@>:T\yNW&ECe_k=nL/Da)<ƜI%y}@PO.nKfnQO{:Òu>E):PCrSv| | |bUa4*% scyi'Ko}OS">_-,{~瞛ML7|~E T@|jh\\+jKcnVuz:=:=:=/%xp N.!1>N>"\#$ K秧Sgh(t^`eg;#U ř0p:C;PEqeX/ J YZ¥x Cj2n-_gAo#W_y1ۗYU"k˶T8k6Zo\L`Rss7VE'-C6z.b g \dd11lmųϋYUrۿevߘOZ(µf`wph0mƶ a٘<^ם= YG_OÁ~} CB23[YtLhUѷpse`L1c crB"7G;ҥ\C ov^K1+p۪a9'JF%ꊘ3!/lƔU/gilӱj]j151.< "jsWZܠ7E4jgq ^ckR0ܶIl3>^}hЅcMz =cO*Zc,h^_2`A\L } 12#ƌetz[ _XȏTX+Ѭg$}<3Y2)slA߂7QzŒ+2cLa;p6庋Q#֪i]DXSz ZNNIe@ 3fR>n1⌖EךUJy0j/bz؜~G+^* ֜w'O}Zk:m8 Ó:u9#@+M}Xݏ B9Hz/gpPNYa ,0͗/ A}rv>I;m |;K+s'T]s072M2VwEԧ^''nG7u1,کtK8B@q:hmOP%?b<a L,[qZ *j^B*Nb?~W nJqNx倻 V } S)zP) b;ƾ*>J1͢J|~U|ʏ4n:dN$ngs'-I,"lsb y\i~0U A9cVt4Z%K[7Ӌ栄]YOrƠ֎ZĠnLwg㠅yjN(.<%-#V^j OVȓIshx!$MR$&Gyv8ACQqNMfvLú|?va#u.|š0/6< x}S1ž,hHTd~'یn] ^p27YaH6k1$ˉa1O >[:_LiZg 0S,,v@fefscZ]Pqqxł9tO EZ,&_`"(UpkS&0"pڊtES oD0VT=уM1b.;v66pR~L#Qמto;ݟ~vi/t hq!4B0ѫ<H] {>v_oH-y}t:'Lx$ M&Iu &&pto셯oIzM%<P<1sN 'n|1pjaW KTHoVVv-"­!xhk,wDS1הW5 {ό#_-533+C;0I \i'2~A<\S+##6K0Mgq_ w&qaw#-;eNR>cvvcn-yfA7kXּ:\o"E"`eH},#7GFk'"8փ5ř! 2PE#g靑;փ4~؝;y>Vxsr*y6+_1+vlS~-I/5muo1mȯ,dFbLF|}<'6-& &IW.8ujR {S%X[Զ` ZÙyʺrkm:]C)ɛj€;b}%wPBNܕwD`wRre,32-bcD|2193t`KqY;|e|2( Z(JVO,je'E9kz.<[N7-Wȹa. w'}' 1M߇r˧ %2aW!.oP{Kč ?3WFFl~T]gMjH,u]W"-b6*rM25keߜѢgV/d83ȸ2> Kj^њp| /P+p3'#idqD/K͜=n/rDIzefgF$/jYOu+vud?ΚWS7<ՏO x?Ӌ۵?KĄ*Qkux"q{:ajC&p#1p#Ѳp#j_*\Qu]˺4 n0gvFp#<>nĿ4ͣ%`.ldnħgB_';:Mx9wb-r?e>$} [tˈh r˔ Wy"qj\N5I'bxNĘ{.F>TcW=~t v96X }uT{vxsmaw\]j7/2;bjFcmDxCaӘdF̬fA JܰWll ̂HrU h#'mJ%I i6=֧t8Zo*H/mC\oVt;ei%=)L NTe#'e0Lb/!NӮ _6ȒXlhwRd+]^:F@WPp7ZY 1(iR0{S&.媸=VKZp[.!**8H8= OLY 0[4/ZuҮ ޹ܩIkbYˡ9ߓ`ƳjKp 2:[Fhw)|,n֦w&~xet)&HfE{OՍCJ/*&*7#O\Ұ 1YRD!,+4IʸN1c'jzY7J;^j q>XjZɎ/?h F- t/f#֫%ْ{o^{ :q7T$G9ꑢ6Be@r8Amo87K_ռOkb˲7isAxk8EQQW'sJRΪEĪ,}drFXµG,n ހZ̀  ĵG1< un,ؔ Eg`GMӗ˖,# \zbCbxCp;Ihe.e&N}anW$f7g)vA>Ҿq=f۬Ր ;R -y-[h_JAY90v z,XpYhC xjj(GWtgi؈J tA4nA^3& 1b8Glh`1^FVLn\s8>s:Ccwk o9Ω-6!.rASS&Lh;sDjҖRJ)e3R' 7JJq·d{製%{;Ʊv%+Zɓt|<8r\Qx\@L Ex z]'? S;=Ċ{73 --i,@3:~Iyo3(6rcSBmnp`؎> |g gB09qo 4&fxevڇo񳃞 (UpFEoc]x%6Tbu؝[A&uڝW1[GIɫ\{1Dc&s7݌+nvϏjݦ-O9`u.p2ApW3 N9Y$)0_Ś-\% !yw-;˜~Tnn뙯_;O}o,E/:J 45hϾxyz KDz#z:^r1C!pCIHʃ$O"{s9._K!MR\2~y`ws)V'\-N*%\#:)Ywړ y ڤk޿',7ܢG3ͤiv0N^ff l>n'p=_/5dp,~w=ƴN*nx}z,k;#e$qZ dyvr< ;5Q\WbzypLI:ixiS]y*孃9J|x|eP{{!,-Й05:C@@^&k)esgeqa VR 6ˮ]ZKF@肞Qzm;wȹ7))\_%Gsԫ_CͪZp~?<"ƿ4\VÍKH#2A4@5^VdoO!ho|bS@Nݴv W Yc7ǰ;XQ4&ݙ'@(̔vo.}c{Y8PO[f"pMGyf闷&`(əӄvn?,RFX  @ N(unj1 (0 :!d`#"h17_Wl[g7m&c3klG?lJeM2>LoF~*/ dS Z _Ȓϩ0^j\W碁-Qw2cO$#\ صaqֆ3iЊbc Oy80l޹O|sۙ;K1 տhjוܠb#{,_"߅tО7,d8<dm%8 2u@g "eo~ 69xɶQ,}SNo CH? q||Zf?QO֮igPdtc,t6sR .p{Z2j S>po?L7-75ñ^exWM:_热sC3ơM5s9dN'?ڂn[F  N Bg, xZL%I JK7DbWB}aI\ _{dݚ`S8|j~u-fb7efHJ<5n?arEWܩmdz.`ɨ:A#͚&tL-z[8?TlVtzGY:Y;d_P-Мw]r"%XDn*}vv>r 8Dp#uSSrl" }t 4q~'{+TZ8nff㽹WSe5g^6u<$xA&^,^ΈOO4tiRv#I-b}+b;\?l@OMXrZ:҉% A=KG9^hL~$@wcLI{عέCZW֟3_-ZW:ԥNu')g^9iۜ(Y}O6՜>R'U^{O~qs[!ɡ':2Naǽ5j}Z8"텇Fז_nbnC*rY'cOuN.[g#j{` 1J^C4ZN E5vr3fbLc'{1VB 5M_)kj5`W2o(:웍JKc#h+SU{}`]'l?9l_,:ՍZ|QT5bRK f&׹>IO@gR|J`b2ީ+&Ra=63ז4KYMP`8a V_' )9k7Jk"&\n[0:R+|X@aEK83cP@o⵺xq8}ͨy\EE,BZ:XZA7[KR o8ϗ"u,qXSR)ȆRV×-EjVq2"-0..3شC d'0%Ȟ<zۖ359̰#ܣGh<58wy%Lڈ/y9x OY^U_(&НR( ?)4Rte|h) 1h}bK/\:E~ҡ?8yCSrߙ"qT$JY Iv i5x8S=V|qAc3uj-V^G-/sEW[p }BnibVX/_F6x񹯽,t)p̗%HZR[L-l8=iZ,|], T Lips+ȓc#NxVX1Adq Li݋bA |ZT}끕`5;ITfs *.IA55&ɰDNŵeEFW -5%=^}(Bq͂Ɛ =Zy]/W/a $ ْB%K}w ڵ,o`icfcKZ3M /k +/B4PБ)%!R2hF,iD[&6(K.#vlaܑ.Y8`:6:dk=nX !2"N q(jTR%R]-]Bicq♥8H.sq hsm,PYfk#4 ߝ 8ˢ~҉Ribb@L-9җ<4+Q; 2A"[R1¡iwuv&vG/6ȩhk|;h)MemhvK* ԇo,9Qa:{}"-Z[tT 4b\w4̶6e.8dfēkJE${PoT2ǵLj #]-& ?-Έ=4A R4dL6hyZԻjEz7G/UdZ6"s@ RoJGZ8~kRsl#D$z5MGkسcEeF6 p]%P/-\_RG[cMtPj gZpB7L[_c"{͌3awU?7ȣˡpwܢ멘.gP/? Rb.A-}P}B ER0nijs۫':"#"Uto˭E(a8a. H=|nX!O%^8Kصi)9(yh<(2&ή#?_gL/HgE{T(T.qȴ\AB@47 = Ri*|@4|"Ĭ DÕ H ȶD: Cz Y"=2 B/+C#l*C, CgsP/D D!. b삐HKDSK8v C4 vev#Dj`(=D&m@HTх!Lz̻e: a ~HB3]l[`vny j>;_D21(R5̀y0| ?=ѺK2WlHo_v~΀2x!@o@r(P݁ Vc"`" PkKcwR0 ~ʰ948nQ7DFium!Fdz2|zd#03S鉠Ѿ"҃|miO8kDrygxP4krJ:n^IӦKqyCfD^##=N9 c߰zF hy['V,#ZjP;6D8KfIKjԺ?Pu\P|AFipHv8,毈.ہv"h8RR4 s<@#{fP-='8i'NAȱoP@S Y4թu~nFKi8;6pv8l[`_3`FGΪfF {'dz"fwzh@; HMi"z ]8Hį12׉86@񍐴oLδ/Ȯ2?|Iۖ(ϿQn XKSQmH Tlkcv=c%&"~GݥSF, E&H[EWD* ܣe7'OFS /V0LmWARm5-!X =hF\xĖ.{,Rx4;3qbozAOUʈs2|1ifRaǁA2?7ZեQ MɡCj *\݆,:@0`32 T8ǒa+-@xuG3fD1[qk+Q1(0jB{x ?e\[WqW8jhi.As $8~};A#LOmK]Yt '.X#3]kz S^'Il6¤ʾ`!E>Gc>Kmpjw`њ}:P|KuT-d:Yb,T.1pძ*ܶ9*J~ɱdƮQxjJґy )#`h_$dC!IbDg $YQ+ifHʘ8F Gl#YH6Q@{(&}2Xq9kްt(H8GwZ"$4e]TH7$9 P$#$Sõ rAfKa" Ղ!ɚ P\LxO ͞9]`䃥s=7tR'Tˑl{H8E̓!hFw֘Ҹ6c]A=J {ѳ<8uy,t%Si`0U<:RET׶zVߔP_[hČǴ%]/AvnAO:ԓ9'!'yoyi[˲܆G;mv; ݰfSޯxs>׳,{zDJRJ7܋^xll4qo[؋<p+Aہ]zxK4ovҳ"Y E3ܶ打58M=OvJtD X5e).#[>Ro5-ּa>؎b}VQ`q1^Ƌ8pX~*X%BuD6){Sc/)T0EP*>ƲK:r{@RidU1ַS k_`dQ,H }:Yb&eZm d S"YƩg`ۊ QLrߠ:9%%6}}2ma!Y)ڗlXl%]]@AVź`˱ڋ2 E)kI;[ .2> ǡpJUAU,9qܾR_('c͔ #\!V ɹ<a'FXL'!ܤ⋰z* &.\)S'd)'nx7??+SorlM#u}<>,fŤVƧy"YFW1ߏV_9Sh~ ~+̎,;nvD,ٚeo~۫>m@ڵg{oŵ1O1 nn8bͦӈ=j>hhzr;E/M}6aODj?[0Al LlTMm`n6za?~Fzv2#d,mglן V\{< 3Hm# 1h61dbD l1ɉJTLȎ&dd 2Waὶ=ފ-*U; NgbG_=ފcˁ 0\8"&bɼ KEx 3x sVE4+/p*Ƌvxnrk[[Ez LG%Q)a<# =쟯?),׶gQK ~5f"HĈ9c bHĈ*10`ĈȔV \ap'.1xxAUXtmoEţGlmƒ_>ײ&~~L#A$iKMHrl]5^RI6og[qm.%yw(Fr5S`s61 ֈ0F, i:&{-BE0 ݏַ6>ZK9%X_\3/Ձ+yCm@*S wFQ yQO|B[, D=#zk(0&yyu\EAzx\z}pl=USqfBaXd 'Vl|=/Gž#B0ch.h}hKNss|4z>'(@QLꎥ_@Di-V|U=:3 挍C"qK:v ƹlt9+"G/ϸ:爾Ov/B+9:"#< j5}9t^5|!۾Ecs>Dq{,f~X& [fdOL!ͽ-sUь;=V_we` :%wބyj3de:{SO'NB/+ ǓƨGo W[*7oiۈ}=N5EUoa wSPտǹ٧``"Op BaגcNB OьApεefEH*9ΎWDl۴Ύm;;f[_-˶MFpV|* U_gqvPP TYub_ / 6u&JJu|i*}9~Û) D+!5oEw(*-%E-=x<yr*]{>"Q% g abFj)9"M-{fGSHKScRLv,uumE$lY$;[@Tcj3FyܢfﰧOUБU)U#Ij(N}^]ǻ{ic(r'$fzU 7 (mcUi|W^/#k;&KT,P^7Ib=Fz< rUA?-.@]m]F@hhNj81{8Ď?x՞"`csqm=P!ܒ6bJ 󶉷~9kÊ|$c#1v+XurRUL4]Y]8dMIK7"` {귋?=lOV ^ WUr{`u64{qgWZڿ!5٪mѵJg~T] ac.UDoAiMqYd `zbsfskkNV׀83^̙ vsCboQ5t~=z*Kl-v8ԑ6hEN( 7$&%\iGu;fZBE &BHH6eHDOb}0 -4дۊ?<4=*4K?aN{k vY_a6*f$zt{3DeU(#вh?Mk9`^9&ޱr6bu'%R{ =p 9#WU3Iق]S?ߩE X#Uq.t#e=L 0d ŢcqcM5+vɝ==JuGH*2(%P,q$,A}$Qc? *+-Z'!MJ1MC*-3cY p[h0cxGDOxxh-vADY4&EhIvюKɓBLOTy+Qm>I@+͖;/遝#y=QVe^Cy(i3"hךGy;8Dy=^ ^kTqxXK#(Ѻc"fC=<յ}%Zu:%BІ*I@=~yTq SUdpڹY8}MЇF&y!{"R4ŧ?,=8]==̀hꊹ6OsP gsA)ì|)Jmd/-_}QbvKjK0 kI lrEeUXf.T?-sx["ʿ/9L k9x QºvC_UX SX{Kvv781Zv KL kB<ΎDb { "Taڅ2 KF v KL<( *v=xڶF+UKk$#Bn%JF ^bKD`5#6lqXɛڅ܂O/VJtMZ 6)[2y:9^"-Df=ܴ&QX_DwOw f~YXvsS@U6ad5 ^^`SB)֋bڈb.Rw+o ȵ7{Qen{?0GP#+UW#Th-Si?Q,=MgG5y;ӸDO| @^/ed99 J!/ELZ"Rb=oĔҬ#7d>[k`R-~fzɟ!\>H䔃0Z%3j$"" a; ܇^/]gOD`Ćpq }xz1Btџh W5Lj\ZNbƀ~5׊vnbDKW|c<@S݊F DBptkzZ T>7>Lu2&w2庺dablDiw2^D|G@먊yr,@ []6HB(-KE(aylW>eqTx+଑{ͭ-܎U̦窵cr9w1;%c|EzL0:KbRvRaʎwߩ_b ^`"@ 6s!-&hrCٻ7qmbG,*fUֶp@_*W#\ i^]/Z\uw}ٿwE$|+"vUx%Qp0Cx[ `서\ZlFgW3u]EnR=$v-pz&gg]Dϣ'iFJԍDS.4'#˚!3dvwb(M`fi:/D)j5,u5̸)< `LM2zf8h V*.#9l*\5)YMq B@;B JbLp@F:G_[K9sXX0 +(2X^ Syu\^A_#{zgQCDh?i\f=U/Q[{=+x^:"<=9@t*@pLAejgK=x桵&sۗ:,rO {y u$ M$iTT/`^"+*"El F6>{Zz\[O0dSEd20dL\|m: #".|2]JCu3ҵ O됔/ @q 1K N ( /.CB_*!W !]uJ#s?SExPxi %,Y`L; ,*Lv)Ls0"/< xh3kKIإ;E.Fu#$_bjnñ)^>`' mjOz!h#ez/|1o(7/bI䒫Ǐ0l0 a#_nM21paWԾfGUmCf >e ISZ\&t{DPa0hR0^cCܹCs:"xu˥@ڂ>ǼxԵ"Wkgy+0߻kC] eZP;Jۅ--rz|a |SVuv@bL.QBC[tWXro[XN)1{5*4ؓJl{7 _vY25ٍL{HPq[cX$BQ%9d&$4J2ꀀ*QxECu˾ƅa)}T]h\sʭ?΍-A7cd-v` !=U[)ɿd-DZ;M[yW姎ULs~'ыn֏S&EPVnFTE&P܈op[3kB,{XC/mL/6EPNoFAcM،_ X0nTe -n&F ۯx,q nƌj{:M¨xy`Aq jH&V=;C+ %oziR:0[ybSqND՚#z52|cSQ-2jMB3` j@RΔ1PLs0}qCp<-1"ބ0io@(|(ԨI+F:(InB{N(kQ9Vw.C^V9Neٮ,RS u*UK2#OX$%V!. @ph0ɜ#mBSE? W}<.͒l:62*gm΋@35Usk3m|…?3eP&tz|mm̑"̞0C0@ʄp,l^$;zD]EHS ITUHHmxɧ@|l@ rbdtDG_V{k .f]UsQΰ*xf:3!I*!wrt5 0g.e9f Fm-1%XZjكX_ULTq45GU1-{FM>0 .K6 jZ{9wLTj$*dI(QRIx aI=J*>.h*cPJZfASճZ_JT=dYv-jqT;଩i!M՟#hlQM HȒj5ij%$>(%ߓ&.%վ,YFI|(4(.B%U`}a#4YluRnPLi$Bm#^mG' ~Of(<2hyEEo U'!!/FpmyW-sA.&ӟ)g9J̸J ^1}>BNY6*c O\qATN1L:Z2vN]_‹wBCʼnX-OΞM`0%J6b暈Vq;@g1wePb8靓?QsN;<}LJ;h:i֐q2U5'$=\YW'T|1ʐyT딵e2ױqQ4$!.ƨ>`qBZ}S.TtK ^lC;W>Յn5ş,U qzmt,\d܎k3hxT[]iOz^}ed@̸a{^9E eF}((a+ca$@IJ ͥ9(ص$4R]%F`E &vD| ,_U"Fs3O /l7a de7cmxM淎lmRؗTim`ܸiž189|Wb[!2I}VQm2Epl E:ZrdƔB[b:Vݥ_ah" l< 17fU!T#Qtva̐0 Qd|/=`H'Mx7a[U VXtOA ?`f 9M jLj15[߶j Zl{,t͉z:ZlQii#E[RDW-{P^C78RlDd :%[GU&'%wWmM؇^Wml%%vVQUUb*gb'.` 99Gre=*#=_&>״m~_>j| C+vI͏ye#ruXw uA=!J6ۋ/g ůHk6~'F[D*z"GCE)?;dm>?6foib'^ěX1,I7郑ӣCoŷluJSBĺK D2ӓ#|̈́=AkLxѕHF[pG._K{edS 3DDEt>UsjT0D{^Ui،-@K}2@savgK>9#m! a0zQt k2H@-mR+2 N 1 S}5,["{x2<,REQn;^8{#HAr1.]aAf9C@bE̴EpzdeA-"c >hO/tdʵ봩vAf{̇΅]D%0e\NU+pE].qIAma\Ƌ0[Ph0 QLv;^FƋ0{za#El BEXvB-bj7pf1=75Iv1 oG A`MS/>g!::'LHM@shw 06! ? a`xצQ~1my2&W7qa`tetND?FuUSU_}_,.«+22x Eyc> Cpv( PҎm^~GVxEbռgN2gupAh\>] T1Ϋ6 $ QXhs<} ޺㑩2fEnόG /} +~(ŋYq#3/bN4yc|)Fƿ.ǣ ֳs&Ƌ6. Ȍ_y7l8 >ߴxO:~_3Rw䎞氆 ?SD%u#Gyք"0K?gs \\<_dxq8Y盼1>V/-dOJrt:׭H27FfUn2`L Nb|񅈄7w;qlL* {O6ЀacfRHrȗŠS83,øb/ Y'M5kzǵB =_cd0i;_h:9R-}ѯĖ׍ m'J3?3eTRZ2d_K"gY"OR5og@IJB(|5Zq@7 *-hM1g~aiwKzv"% ~nQ\Y$nﰥ`-w H75thlPXы<\F񡇸1"Dfi3$`٬xr9B˦TVח2LFçEC& XIz動*w g(zϙ)2㩒9؎|Q*Bs0ٷ'm.5H!s}oY4oƭ f=voRCTk@5= 9U;6!}iLؼ؁Q? ׯ?]ze >Pd4;"V=ro3 rАqnOBZFc%w9lQo 5Okh*-2CIu3_;+:PJr`Gr$)D-nkY}U -QZÙH3gV[DXYb=Ac#_9l$̘woɳ{B Fgڃ%h">z',Vw"zB,P$ty 90]6S`"2}#g9<x^t%G\޲ˆt+ƋhaT;QxGGcrND9b_oDNi|yEf"٩JvSmߦK4عOo <5P/Ӷ%X%Zurx1s5x"}:vj䖞fWy"1xqdpwZ=VZ"^+o?Hz x"0Qz4k|y7wRUGE:i Ky?Ƌh,AD5Ȳ"M}-KN2Xo?rF vG溻xdIx4(|F\ɔ< ̯T+Dⱕx48LKQf$KmC{ٰ/ 2jAj @]r,hsK&^-*Yn\G H<Ўq,QydWן pBq%W/2^O^mۂi]F|.GҨ?bͧ2̊kIt}/'Җ?ekas`'a\:'LVkuK CkqݻƔ}õ^vYDfpp|q-Ӳ!nuZgw6+188i[x!:|ڰ?{i7m?)N`drq߈vf|V\MqGs L'rkOB= H2jK?شc3#ia{ᅸa;t2['`OWHqE3\AQbT(gbVuWX6n1z ws5ïgϬ>Y~ [o_rUcVE+8J(RZR3]"3l6Wؔ$|_Efmhd1ϤۏnװwZ?7Xq| )=ђFF+ڦ)ld4k̀SM7Vӏ JT,^hU oE801̀YIKRxt 5cag_zGvY#r #?\U)B fFdjCVR3]A\ۏ\UĪ¯+p25(2g}ˌlMyl>~+f۸kn||oA]Μ:7kh*֙a=R+z-=Ha0;7|xE\ }_Y+n/u09Ob&NR2&?H6m[kXW x,.W.6z X Ն5YMl|./Ar|#Z 6v8%IZU&s|_ .Ux[^EK1_dP.Lt\VR4QXWNx&o |`J̄6{ HL/ 3K_QFEF쭨Ef3]`pxf<7*2z%^C7fFzZBHiUW#< zk6~iW1_+2a3npE88#7|ߗFh":bLДw~Z:_Wk2JAyB r(8#@^1LQQ})0 2^ПId(t8ΗM ڭ% .ŬXYO?N׿A Yf`!53Cj~npgz_&~nfAnp}[0jeww+`s ^K]%J h9y9Á(X~=Av_<".#Bpϡ9dTmdf6)QL7r\! N_Ʒ&b/etv [ɀUl 5)/Γ#2j_ @4C2ŵP@9ż,?L࿈S_^S{u|Zg 9w_Ѡuq0/V 4l藏6,>r(16`< yp~=dǴu!pzgPfVY)ء@z)dHW&WdF6w6pGH1? z L .p2#x{^;+1 gG ]Q" ++g!Cj>6&`]TdӁ Q] [ nA!f֙Vˊ Y(ОS@AQxp Zpꋬ07bF(2x-+ȰR"3**FVzDQ#(`"D@tR*y.ΌƳ~gй wυJ&50lz gƙ[ұUxGFEIa7#ͭȌy+NZf\7͎g^ŲLf.WLA%d96q'P$rr9Tpw{? Ll}ƙn֯S^G`ܰWV8􁉽C01NMdL2Z (7sz #ۅ7eA z,^#0 3oo#ڲD QVz} _fw|R((Bb(&#]|Z"h3W2u:+tKEL!e7B9Jl7#"ܦ(` 8xj{=G=:jlQݢzG!bM֓AOλ@/!h+ CDX:(_F~lgQEMb,l%ݿ fxA/gLp@ʞ{Cg@}(#"7Hz7!KJRd%i2>%~6jW_讫Ǯ-ՖL6`N@@\j52-(SıMO܄WXRAv !2^ Dkҫ%6c(niA[d!YDDi` 49wsɼ[kRyۂÇ<0Q<"5?C2 rۋH {/hBWf`6{uDϞ(z]P#`=8 f R ظdHR:(֟=+'!1m6(\b E$䘿/bMDA; mm7yOLpׂ E}sۍX^4]zOO>:HFDЦqFmAvIA;#"K㈈cŐ.]4fpu mO)UYD@feC*k8[cDnpfHLjIݻ3ЂҎr^=@mvFC:OQ40 A(<܁WylvEThwaDmAsF ICNWmo~jkR[k{YE'vI7MoZ `YXޥ"LdnYưJ|+m*&tjTQ.;[eRYi[doɦV\zP*9[1;HTּEKYeVYa*klg X>%,SYK_^)#/f7/ )W\߭D:M`gƉ(RY'_=Ç' rD嗱ŭ澽>:kyz,j2MZn'_aRY낈~f*k%x VYQθvgUTuFq dJyÈcsOg`^qxnvPAV<,x==~:<'С)TkO y,zK;ZC"oAo}SG#O*}3FDmվgް"%[sFct#-iөǩ8_0,#"=ɠW>w!Φr1p[x-0ȖUR4wZyetOWSdy V_Zr\]υDñ;-LvM{\W'KÌǰ/k/b}7|jVe62DWc4ODʰ07q@`(ꇒ郢⊈Na= O6#_8}e)&0< z匈^q:!)fk\[DR—{<=ED-O{a_4!cԝ| Eug]e:^HKKmDPfv/ƙLx5yg!"xrlų{jdHO2j ^qzs!FDI۽ڼsgGD IገX<߷ҵTEuk1޺l%CF"3aDD#V:*Uhs2NlDu0"6$C;V2OCo ".H=avm+|NjߨP{=pVyylfDmVx|63]r|PJ pyv쁲&(]ř²}$VۖQFk GFѾR̉# Kpx%OKTDc`l$]묭EӮC"ڒДMQ˖q뉗 |=cۃ +B;!qPN"ݧM1FvDpݩ 2 :J n~Lcջ{)be)>!rH%pD7)p=D4PV?˯({'OX(?3;j0m|m~_ʹ/Dl̇sVs.l=zYEZ䥶` l[ {nA[t?vs$ E*_R^]-i pU+dI?Jݙ]έR,WCE±!9ğ^z@P%@Ojqb${`$H)>KSHhCy u Pܝ59^iYA1Hr-k/kY8] ڱڥF)K]o=v,DԾ޺ ]Dz)&UѦ-` z4mVg u dő2I{}WKLrA;{A :^=@ ^)o6wY뙲i»ޖ^mɦ=TpFJYzian߃G:CdH鰧 c߳ip;5RKv\dl=5:M=9[N*.{rLrܪ,AĠ>H9"d5;f3P0'|TFFM/LBsz@?3.^@pO2"1*ADxV6w@E"]q~k&2.Fq5P. ]~v1a FŖEHזKiо8Rj=U| Nh=_Rn,X:4ĵLt4JqZY T`˾tX|9t9H(PG$/>h_B%8h9Neya}k8|2n[vxr[, %d.$NTv ;Wlӂk) 5nr&) `W')c~}Aس{?!h9< {Vʞ "38FDVP"{yj0Ε73v$}ub%Vy`O#M(;3Z7ĸOg:V.Qjv8⫏oM`hk\y 21"W1""ֽHz`嶤toz(`s(w.Y[-H@}rvn10dB|+c`2aꏆb="#8\ģe86,]h2ĉW`ʪq3gRd '% 3<9OO+`G#".3h.^c Q+&H30 [֍>=v*g`A |.kma6m[/]WO-]NxFH[}r ;}k`Dm _:qvG?lwl6=0K;f|ІLioǙ$cN_^aHC|İFQtyiP^5[֓qz32v&Dٮd^v̸wSG8cr+ S쯾*Y A&bA99D٥O)2r떸eiw#!hs"bL} q1"62Z "X(llw9ZMb2S5vC=Oc$ ψ[0[6=apI&|8EQX̮x79#G}UBKyVQ9FD<';{ҦW"6ӭH z2o!>{{lڭBlax~96 @A>i{{\|f{CPzhSoͫ"R(O>dkMD __q~%zHGx{3="B٬LjXasmJ[sm2*K0>#"!K/PdD=#}1B`q2"30 4k_Sܼ8fWĖ l+&#/P.50RMW}F&9g*Y۾R9H4Fy@GiTbeErr:<> " ہH5^(!OH2WLMkq)dy<7릥3􍌢ܑ"2V 's/(A4TW腓cK'^tP|pDrZF*|IBj:QXXA=ME^>yZ{ d_볪uTڢAb/ʫC ˈg𪵿tZkfTk]屪sªֶUtjгE,#"h<#UQQ-ɹUg*v/N~XZ'Zk Wu筧InjmUkGӁQ|^ a˴j{9jm:dU۫CΩ9F^b0Ӫ9WuFKfvZj쬟?ZgZfiҶUW}eUD{Tˆ ;k7q?@0/V/?3:2^ I[RFDn#;F90H3{F+0Wqyz%cl3IJGAQRbzycs,acNesB#9B2~2j)c|.g| m 2"6O =ED0`I)#"b۫z~{vRcW#ՇQT/luWb7Tzt'kD&B̔^>[L'ǩbvRm9c|)J5ՌTs;>.#fIAt#7;'I]I]HiսTk4ǗTpa}rVUpq/lD}ELjQW`qEX#0"B=CgXgŻNn\k/z!:L.b7X'oZca1"62[B>+꽪.8m[#QeYi0m6lhԁt0RVN44tۑe!ES9t"?Qa#XݟܻQD;,'(0kA+=&sUb=E ZN$fXk+0&R\GZ({E^ =DhDۖgun>oy.Bd}-oQDV!*Y|6ޮ}ޣp Ⱥ ÄkiNQ؄o Z"3*I+kQ6<:Q9ǫˊ$sXaS=^{=WQ(G.ǫ6۷Ǎx):9Zh-zݘrjk?}_ DTg%YuXu (q CmDaACq gCA4SbnŐэrS 3}}cTAS@?]m>C/h۳SP/ᜰ߱9U#4Dz]s\v˩IO痙K^9> stream Hbbbccceeehi3knort 2v4yTz{'~*QgSijt&v(y*HJMѐӓ֔ ?MAODR~͠ϣң #7913B&d(f*h<>@%')DrFtHv&nspuϝџ`acׂ"٬ڭHܾWX !" q"#,[\ ;w endstream endobj 215 0 obj << /ColorSpace 1230 0 R /Coords [ 174.481 404.48399 173.897 404.48399 ] /Function 214 0 R /ShadingType 2 >> endobj 216 0 obj << /Length 46 /FunctionType 0 /Encode [ 0 4 ] /BitsPerSample 24 /Domain [ 0 1 ] /Size [ 5 ] /Range [ 0 1 0 1 0 1 ] /Decode [ 0 1 0 1 0 1 ] >> stream ҵ ~IKNnnnooorrr endstream endobj 217 0 obj << /ColorSpace 1230 0 R /Coords [ 170.666 404.48399 170.119 404.48399 ] /Function 216 0 R /ShadingType 2 >> endobj 218 0 obj << /Length 16 /FunctionType 0 /Encode [ 0 4 ] /BitsPerSample 24 /Domain [ 0 1 ] /Size [ 5 ] /Range [ 0 1 ] /Decode [ 0 1 ] >> stream ?AKXe3qo endstream endobj 219 0 obj << /ColorSpace /DeviceGray /Coords [ 251.21899 428.043 251.116 428.043 ] /Function 218 0 R /ShadingType 2 >> endobj 220 0 obj << /Length 79 /FunctionType 0 /Encode [ 0 25 ] /BitsPerSample 24 /Domain [ 0 1 ] /Size [ 26 ] /Range [ 0 1 ] /Decode [ 0 1 ] >> stream xy=C+xxxxxxxxxxxxxxxxxxx2C>NOv endstream endobj 221 0 obj << /ColorSpace /DeviceGray /Coords [ 251.116 428.043 248.16499 428.043 ] /Function 220 0 R /ShadingType 2 >> endobj 222 0 obj << /Length 294 /FunctionType 0 /Filter /FlateDecode /Encode [ 0 30 ] /BitsPerSample 24 /Domain [ 0 1 ] /Size [ 31 ] /Range [ 0 1 0 1 0 1 ] /Decode [ 0 1 0 1 0 1 ] >> stream Hbbbccceeehipkn.o/r2t AvCybz{'~*RYT[kt?vAyCHJM쳐  #?yA{D~%'*prǭ쳴&(*<>@%')EGItnpϝџa\b]d_ ׃.##٭{ڮ|HܿXWlXm # $ % Z!["\q"#,[\ 9 endstream endobj 223 0 obj << /ColorSpace 1230 0 R /Coords [ 437.07401 170.616 436.49001 170.616 ] /Function 222 0 R /ShadingType 2 >> endobj 224 0 obj << /Length 46 /FunctionType 0 /Encode [ 0 4 ] /BitsPerSample 24 /Domain [ 0 1 ] /Size [ 5 ] /Range [ 0 1 0 1 0 1 ] /Decode [ 0 1 0 1 0 1 ] >> stream ³śǝnnnooorrr endstream endobj 225 0 obj << /ColorSpace 1230 0 R /Coords [ 433.259 170.616 432.71201 170.616 ] /Function 224 0 R /ShadingType 2 >> endobj 226 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1194 0 R /Contents 228 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources 227 0 R /Type /Page >> endobj 227 0 obj << /ColorSpace << /Cs6 1230 0 R >> /Font << /TT2 459 0 R /TT4 1246 0 R /TT6 400 0 R /TT8 403 0 R /F3 413 0 R >> /ProcSet [ /PDF /Text ] /ExtGState << /GS1 1251 0 R /GS2 457 0 R >> >> endobj 228 0 obj << /Length 61945 /Filter /FlateDecode >> stream HW˒6+pI{ۻ؃[5G[Rw7|olfHI=GG,P(dy\5EtMTZ3!mq\]~>k.:Sڒ̝v&׺l~+wє ,pSʭM6dWOɬNkcgiϒ}/\Z sm3Ԋ5ҵ+F;YaW*kCʟS ۈ]71 6LasmWqkcw|a㾍B'ۛ["t%H)6K6:Y"ڮ2C޸$Y=w%?f$ɏ>x [׻a;<;3Z.WՔSf{X bfy7v%Ms0qe[R^w)_1o%toϣy:7X5Na@eX+kT,WWtÓLގ`z/Vq~a:Qa)8' Vº h elmcnI?lwۺ8UkO*pyiQ?H/ ^<`= %;lً8=ωBmRyǠw1\I{D {f8Wf?\>=4ViwQ HI }$o/GƒT#}=7zЈM*4l:0VC>uL} m ơT٬,؈&mķ=Kto-T&OtfMnmhs֚84ˈ+mP蜔!6"&Ahrf߳⍧,;q%g4 쳷Q߆"&U15W#hEvm`'̞. aS$&.nlKfRE2f\`ҕ%8c\,m@/^L&V/XQ7A hP,^*F 6Ț}8Y^ɚ]`ȐDe*bJ!#ϳ.IgSx3A *s4YeI5-Nn"JT{;$F4/1#6˯~TX4Hf#6Cy baΩvA')/g8+'P`*UIC6-F"UNZaƭoԓjjyWk+[~ud%X-] um)3l>닀@xyV]qpWW+W>`}ye;''J=G $7+~ :.7Ԋ֗$F ^j|q<*sbwG0jLrqN2Wp2xadB^Cӡ3y=l|mE GHV5D*Ĉ>٢#gT%수!0caħ$#dUd]G&3hrUz_Mi)c]6lgnCCh#[HD S3pZsشC3'wkh*|jqBj8AJPQ"]F&`PQ ܻ2F"h.phD##EeFbSr>o84́U ;h;qY , z|q(9q%,zq;Э<ݚDQg:zXsу6y"WIDEE0e`b"zY#GXW_,b^TusM0[f^(wYLqL2cpQVtrh: HP({r |!]bwH)BRCșeRlΐ Ac%օW=8iᲯ`nkpJً% E, ×pϕ3&{+Af7y+iSGKkSTŢi{Exy xצ  1p6_D=J3ʣbi3]}vxx|:P= O&[D;Z3'@Cov ,tR8%4~L)Ea؈@VF* G1;͒X;;4 bD[eՆ!%4ᨰW$d;U( h4L/gKDB Mk$I 6M1-I j{  ]ou6rj|1Ka=K-iLO'j5ht `ND( 6%k$7R Q&?5 ~mVX%Ҝ_ǟ _9 y]Mʡ-[-mTif5\w,*Kszr™SԿ?!kP홦5k䅕d uB-WL\vP5u&g&vPBci0pSTB>[%耍ObXxFCB ATK;>cҞsP$jvK[ND0kd]yE.h+{_kzI(ќ ':2#Xc:v[?~vAk) EN:1=T>> hK3\̾v* L]+O9>B۬|vn([ko EHE+㈤t:KR8i$8w&0jJdeD569>qH1o[crbq~mKBX2mC8N,*A ~lΪP'xZѨA!&ԅ}df ΕQNrѷW:Em*\nDC< ]_zMk d;+XKe Sl')VXCGOH4RôuO·>rz햖}l20t>RxQQ+X7y+L;<_1֔Xa]t}QR($X@cQRѼ iᡖHr׫l/ьu,wW{n_uf)#zkӺQVhlP2% q!N!E. IcFש͂Y4FדxЀty c XӰ2~A?l3L%xA1MgPzG#^BPCVb Ce\.Gp0xh#_ttN'5m 딝`ّPlC1tr츁^O@eE/q@ bF,:}#Yﭝ{]zK}C>]fhҬ+=Oh(plc+Nܣ&V~j5 k$=VgWֲ=L AgdarwwE@v7D'7F.l$0#lx󥤧9:驁>TY=!8+`C:rKϷ?(w)7XΫ~puNB]E\ۿug.G nY9ާw,oX>J/tDǻ1(*UU\Bvpo rlU=z_ i=KL\MTxOvWlQܠa-GWyK #dfGͱm)QDw;#OvQ+uTWp?-Gd@6g<+&_:E<0/*:T?W:Bxդ.F,nezrk^[EO%hxm'wE?~ɁB/ױ>u:]Gת&| ]pOO?~%5Z?.2㷗E|Gu{^(ݢ".:g ]o xx,{>mn{zTڮ<Y8Qn^L߄9'h}b{(+=>՗?=VYgJ Տ9x(>see%0/7mM%jAJLpzE-cdox|u1P$tfh Ek6Qؕf? J:;h5CH@2i!{f=lFApiF;-_;_'"S(cR x ۋȮf?_RiYl^ ٳIJl$5>(:CA%PֈbD9MF-@9d;Pbp8ۭY4U>O39l*}tmC;phJ6SؖaS[-x5 ܦ!e&SLI }SbtPÞF_h[ӬuWb{{Zz3ܷz|\34`ֽk1{:n+D 3O[5<҆lΚp!$RAݡ'(ty m@I3;g*3=eRDqxaC8r^>WQ1UXl^;{β TUYQu43<5 P;znavǣ͚JĮ[(g״Sx ,'@P*t"Ts\H H]`f/#ln4s6(J{wz'byVz1Ib1-s:lju OSñDQydyXfnh6g@g$>PhK*o3/1VV\95 [Ͻڮ힇l*:!--%I,`{^9}$Jws_H*GJ5H#~2íe4*87C# AP\1/? Z5C,o秿)DF[)ӪNBd5Qtv^B\#ȓ[7MS#B‰t+u"|wfEF<tnO5;Dx7sSr pSLk:sF|#֜)f:L{Fk;5Hi{Aɦ숑jyHa]WJT9shuS2?Ҵ[dŴ!m>EE(p-+$Qf[ : ؾ%.F䗛+?dCit I'Wd)=qv ${_=m6EvTnO=cE=Ru#T[-/-H3嗯mA05Ec9mLD UGNO91< 1ܟ䰢)װY+Gj=uv3qKX{'@aP+A]Ȯt8{~+ڰM:[Ե5-9ךv*$t`o:%♐bǘHF2+ b@]wucnc "/=¢=NŤz ]gFdZ·B#kbם=W>;h t# H[w1q`a*$Wb'sp&UXKۊYVsL/}JYlzN$V5demm&l02#xRy=6߶pJU6Ub6K9NXү#n{\B\;ev_40)Fi3L="u}ʹU-o^̒,d0+\DMUvFa85.gF/g#JHl_,WZ_?SN]htc}2nvNTۢ$wL<%9Ҏ]Fк,(#G4~B]PDu"~,v08XB]\UݽmNO4[XLu1 o,quLv;H8M}&PK!p)R`XӲgn Щٲã`@(@]lҖɹ5+v򪿪I~6cKspRd|TqMJc36V)OIT(X Ԧ(oX)t #FG5"`+2"J ?-fWnDWa,g]Wt۵Oc̥ɅEl-.Y]+&?j+%K˦HQP(D+Gi# Ұ4Z9Y (Y_y~o.o9g OAB-$SbxٟDGZm10 d62n: ]2ie2T.Ww MqB+>)$NfYņ $GK=Bl,5FbKnZ3 3Xw{jɳot+E{=V4(-2V;s=fǔ6 '`q8dٍpD^-5ƋnIP(]Z7aMaJM4PdtfD^]y^*>0**ǫJW1XT>w1< uGU9~x=狌F!ꖕ}9΢ ,x_YNWvyr 2?x?@W Ծ?Ţ !/+:R\uhRkgB31 d44;p i)m\1Oi\i/eD oL3㾫9J|DF4&FG.F.IWuWjş5z]絽+x~*wE.vuVSEQu{~vTnM!bT y]i j7T[ ķRDִS6#܁"#XtV5{ߵϯ߾bSv#j?kxYiR(>Cn +5HWo2C ag]XT7KTkJ%Ks.m\ı$# c8H{fN2-ukHM-}/ |҇sJudL!~l#C%mcǨ#jAonv҂qZ"Sӷ<"b4\nivCkh Um #:,:r ;Pł3?T,/\VT&2~'2@ 4ђ"~?(g&ѝc8B Ic|zCu`|xjvG;[Yx0j`ҎhǴ  2#τ v3@Y3AkV2%ݞO$c=rH B4)p,xU\g9C$u>׬?Ү eIbYv@ʚвоq#vGxEOog6G9 exB (\]Y]C-{ݵ65FI5\Usx?d I^^h#[d_K5Rn8AZD x;qȤ3#L!t<;j-!T_g镺{9wϟŊMA)SrTK Dլ^g;sM(CװRϵvk8V ǚiM^Ⱥ>QC͗Dv^Ī 9#{//l`CcTh]M|Ʒxp: 4b)"ǿWO Q"E"n-J-,WȊ"% äu%HOA#b>Q PO0|4^ p!@d덭obḍx%3htQo2-qӭe:E{R-K. ]\YS}Rmo; J$./$65ۘe >cUq)6zQu9·4D@ /܍xxGcUM߂4tntT_86BD?R Mx 0L\G'#p1t:!s $VFX)礇rh@]3Ouw})~+P1TvJ?bZ Jb9sHB bKWA^sʦCQ;V5Lk)4T"4Yj۱%GEbQth=0D\C"b+Vu<U+ >E QyYثH Tm5OY,_I'_w_)Nde<9sO]ڞ澝bcNqؤyυBT;9ۨN3f>g\%$ʚ{nW[R*7o[pja>sq9Yİdm턶xޫFߢnR,("G^p '\hK=jǚ%(;l.a7S5pqK`v ︻J1"鰰M1;jÀvwr!cxԕ/ۘNK:&VIJR(!aZz, lo|v:q),@p8Bk.?ߏE9gfx=iCPǶYpcEkY.G#ҥ `=2v ȨY ȌƭTH=F,@>J`plze-ksVԻkdҜժ ~9f  ~ϝpwMd`0N“#U3)tK8[*KT%;DRObDfcê/̔֊[߅eʏ:'-e)_s8jcN2jN"d2v;e^>t)GzYƫmG=VDuZ< ='txI]ߘ.'En~r_NW_q=r68qa/0* )5[ =8U_~/vhJz2GG7;-{ikO3JM}v~.}J%x<=ij&dPfV%ҽss{sMu{r2yť0r!R 9αe^Hmy]lܑOG쒒Dʜd < ˛?H3iᮮ3vp)0 s<ý>vB\_>?7P*u_SaϩZ'#؄΅}_l#liy醞⬸/C)!VfFEN=]/?|U()&ހl6xDu3To%±W/J0øhԟ9+o6DEɹTL+nnB٢msW FMLGaIG =kmq0KOiϼIŚw 2<#žΦGj7s?^iiB M"++1o 2f.= sQf:oĪ7y蒢W8j2vvq^&xؤz}4hîDZf6pF8pBx ؀GTgv1 @Nr>h ۤF9c惽ڡ/h8xA6)`9j'sIx/<(^4.͡v?bLupבKxg?hs< `+]flx6v/[660x,!@0!ǭ_1@!. ٣v0rk)p(ۍ{q<â$h.c-mFA])ihy%F]w2#͘59%Dvb#` hfiQ"w@1ػ f[P+cgo <T'ew!99U0g:cd7I6 iҴ!_%^WXAFY@#NH}E< F_(*F6J)*҃-t?@ 8{=u0G˃0Wިl9J'ԡhdPQD.v{.i<4=ኇ>e?֜AwkAE98DSwmQ iL#tFeу@vf:0c!eK3<]RΜx'0C/*Q}̜|Q h{-_\9Bq vҌ{=," OH,?YYEUP'-mi9l ɱ"BlԌqZSkU63OELY4gdaWTL#8CfB;iYTSqmu KQCrbG\aboPeBubQ3DǎQy:(TiР2(O~̽uף@zL%&5 :4,ڗR"l+5߬(Yn.{ /f'%桄{g'#cfۺ쀟# ']jiQ%R٥B#>ИǼ(“+<^$dG,`(XTst߮H=X`ꂅ  # -)\ꙓZ8K)Lӂ~"h4GQZH{mW9.~н}zx[ˬ}п>~#eQ! el Tgu#}Y:8/tULy܇TG4pmQ6:Ѕp?hsCs36:شvm#J鑦Bnt 3MhH\b;\q(7_|Z={=_L~ 藐chˈڇ-\ xxh%AAI44 a0a?xxn3{}߰+ NMb?oy=)_nQگ ύ"vxF~WZxe)-џ@Կl=cKŎ nY%{8 ?vTGz+_-~–`rl=v>$$Cl> #ԓBW'cEyzi{W#B0?ji~T<ſ~H5t T_ãd1WO~] ٬bV4.sSexGU!-^/PGPX %6ݺ2jy=_R_y~Et,WQ8h|REVJM}vHﴼŴjWUL1U*MzvRb8&"7Lt}AkŒj)XKcVm$3!l;rґS\Dn{84Nʨ*.{_Z^B4KMԐLL"7e'KPMņWx2Erɡty*OPˡ'OTjW"cSo89u _Oj3N@oTnZ4&ҊOeCZ(: QQ=!Lح :* XHpx;O&"ク&v gtYbIOOе8f jKwjbPKEK5άwcĨCKwõG{cNmCvvVT*]wJl d63PC[ z33Q$uFܧ7ũ*N %{$ǘƬ`25 #:n2=öwgvQ)h#dk^..rIDvt#1m?^z13n\=tݾ&FU{hE뼽qf4YKtYfР3a&5gw?•)(cOP*Ul]sT5d+1:Fjl5mXyJ~igNwM[ O0vbp.νTPbY(9)*E}H~~qn[uL14>;hr$5iW9ϸ`}(~ ^7%gE^ nQ^ ʭ%Ha!qdD+X~sYi@ 'RɃZ qէ VZ> !1iR`TȊMA/~!W*3bD55نx{A%j'rc+njBꨡ U ƝLa9eE6|BSJkJKf tdJFD{wSS=U!{IK"UT;頲-\jll~%$vL7pD=3Z;=/Qc4jfR*q%Zn(jS I3,fSƏ/j1o1 De@0*,H;@iAD)|a88(|Y9[LGnx/&} 2`Ŕ00c,C +}JF):}dFYcz}I) \u4]NPp׌;x#&@VytU^o`Hbӊ[=YX9Z̶}xXA1񻁆h."]ىkqٯqB/\_#x@d_=.]QBH8ͩ9WLйݣC2bTq(a?(ͯycDx/ZNN'sCHbC _ͅwykb곿 #JQof>bv_jԩ[_,V++ *c߼~Pn'wr7]}E34^dGsifk\wd+Iˀ[drO_wP>#B@jFjewq]0(i]TM~+Àliݯ,3'u#D#k㜤( Ф+u;bΝKxД=;Og$Q)(y 0y}2˪={ Ǐ4DY+O:]j~YHl9@?~WXج~Ӑya_^ϥb4&k ##W_PC:R2MY9TIpMٷwrn5 !дВD'phDf$젚 Z+kwE\7Ki->twJW~Ͽe}k#EO޳w#OQ!"ښweE7BҡZ~Yyw~Y Dkg4)<ƻO9Aƃ1*YZN포/ܟ@1|"ID] `@LRZt6DLuwu`(;8zjΨ>vg䐃{z!Ƨ>U:[=wYWz kn=^dmPT ||4)?rtǢc۬Ccf)n۝-BvS}g4wx n& /P}|_NJ,aO[] 7*6 g|9+r(x`@;'뚻 qFģڀ i|9+H[a>,,Z}أ Aqʺr mX^!X۝V$o-k]E*mCaDboḞ#7(m>>xYZhVib])xDD ~n]IkE=.&(@Ծ]i^QHV)1R-xLԼԅ!-,Y7r)y4xpD%< %.zi11cA1\i#fC.wtBQWA}.adNmhn3Ah72ұk233QC#)/v;r6 }g>VgB*,;wq6y"sΪ4K @´D9H;X̰CWNIZ>RT"b8&ȁHF?lIjqհ䦱}(%{"6&ӭG9xʒO!,KE*}dfޖY O_Be* -IHx^P X]Sbabzl)6@JXd[QNcݒXƎn ‡X r (xje(>9o߲fzF~Bh"8,=T1*kvɝX~bÿ~WHL.. dF=ިA;GAn{|7r4I XAFе, Ǥ hک!_9Zz~n_2em>AqIץDSZ.;hML[?PنvYt޸΃x%J\X@~J;J /ƒeGlMET~BvUPՔV;Sޓc w+ /Ey_:8rDt TӢ-/{tZwK6ޥ'_p?<d'"rmױ$p[:ʢK2F x G>AphFue>Ú@' aeQA(#}@Tfoz8X(y#H⎡t,Y҉5㗩mVLw#+CvKg/NjڋfQ*%'6t> 砧v,0Pߙ@nL]d9ܞbH_=([9* PuNwY`.s\UlidrW-4 Ӊ^cc -pM"+q2QO[:%<}@o$H3.p~t7q𖜋zP6CnP$M^@aXbz B?kO{W9rd u `P{G`B:rA5$M9_q8@׫K"5mcN7^jB\"/ѽ3`??^?F[~)-V&띖<${$TmNsr"&hn<9>X= x+_$եPC˂*DY0G8CiS&@ho}"S 5w 7B_js /y.w;h7KN}ٕ'*^E 6='}_SjnZP9VQ̶wq9yfU7X'Tv3ڡxQ(ȉ;.\fsBeHTu}0 UӦZSgY9D53]s5SqUð\+w̆fEbמ3ˉ cfVQp~f{Y怲O}>HJ0Yfw_Sb2Fr/xEJ2Rbb42tcl=Va #e羃7ԁݎA8]8f)2}I pHJt4=[bAN|CxzElo& ܟbÚM\x;1ni kqYAv3n4fAYuCçRqs#rJ/Y{04!-HL{ž]32KDQ!CәUO̜͟țfPTRՙ1RfBrumEzIxYyδyQ:K%PKI=&nWp|\`><ܖO<>P8Лg{[+ GBJԜq3pz&kD\M><+U֢w 5n`qЛ-˰’Et Hc>>hVi FEIh7wa͢Ai 8r 셶4nEqr'65XQe>hbն++0_j !H6ÞLG;jjjO)=Rh/z+S\~ a/2!~[yA=@-ae^w )Gq~s(m1EWcB.01vX$w˨4T$Pg|.gty""w1;.#%3Kׅt# u(M"W_K)UGVyq{~/hLj&R`(m5OcGif wxzS "<_eY6Ӿ`tSTU7͓vGoR 1FD^u4g;kOبH9yi/\9۬'Gz*RÛ_S?Г<'CG h';3H[A!f6HɁ&9ޒCv0R:y <œpco ز/i-@GH(OYZAJE)UM/]Aۯdj`sx0TzDWtT 9*hjlO>gxTeuYⅫzM/ݗ^"9ԖɐH:Kq'оg$;=˭Dem^Jdĝxd㪢۞X2nFq`j0C5 ISN@)Q3Dg(_x:~B&*[fZ־=C6BtEiȮy(#4i}l5X?sy3#Ƌ˗hp^< giE d l3\vomJܒ.Q_SuCxOBs616jYZG\ROQFSd#d\ԠgAGؑ=/qpJq,_^mx+#}U]1|]̡)saZv(wd7/b_1G(]iefpGW՟䋷Ҁ}^Tpdf*+(km^X<3iUyj+SD"u4=B(6+M:a4+M-Ӝ}B2c BOh-s)Lv!]nx%nӌk.AZٳ GX* 7;ay/9y)q?Dfh5i}7 iL L-P0rtYZY% ;(0bݶӭu%p1st,n?b;1A;O.FEjbT"<˼Tz2I솁O#sxVrqJD'HbHdzOˉS~;%92p=HHnsѢp)G3%{I17 k}~N֚yDNwukRU9uQz\$a]n1ܤ\š) FAg'\E/Vwy4ya}4)kk8nuVvgZ\>O:X}da=TI)z7SOK~[ͷ+zg͞csK}8AAܶeJ&ٶvwUM̀OI&@6Ŭ gdIҼsuHvF2^P6UV8]Oϥ5f7hf rY\Z%;$ nZf;^\~brXFH2f9u8Nj \㱔~={eƠ2UAx]r3[KeXp>Io\ ;O,eq_O$*w"›qv-57cH]X2wǟ,̇Ww0 ^udQ YAyh^o:x9)2쮳[Wu*9oڂR!LjeR6 6+iٙm, \SԜ꣺'w{O}_YWpGO j %:1VV|-[iR#d]*D9_kkbzrz\ *=S4USZ}Dʠg |SEkx?/\ 8J`?Rl$;5|iҕ LA# PE-QUqaBQvl`h>d[CUPr'nB3eT ӥف7sa@Z*Mq#O߿0}a+|sܡR O"RXH̎ i"ٖ?,P8._\b#rOP ܠBҸ<k3v@9Q9 ­T:n<.(0/6|=J܀ ݭ9[ЮFU>.IWKm0[., qg-J@ 8BRbd,c{He L"CeAJY!9/b!X.lW ѽS>+  <>hefaA〲 -7n;PI0N5dWZZ%ھLƂ5Xf!"7y1W`>|N]b 1L Rњucdp_C.qUȚB;0T1KSz'T~fQ e|BRz|H(d$ r\"56Y*&`1/W.QUNj\7-{טh Y sGCZ-m2T1xJ3\7FD#(z"G- 4}$kBy7m ^gexȄUϲwWEbNNsڕQ2~`|}jHDx+<ՁRgzy~* ٲJMz Iצ1@:Ha{ 8A ɦH2௳ˍ_>n@뭻n@So"z+XrʒT..2zLOIyLG=^, C~˸2).zJWm!XZb;<1u?m9%8=ЄBJi YY ?d 17i@`sG gwԌ.YBlߙD.%,nOwpwQͥ͜m4ǐk |Tj c]Z B-dP%G4 9. 7GIF} 6,'[V%K5i5}|`*MS ~a qZ(ي'c`dv/siu-q۬BqR(:G9i7xh@A!჏^ `*UU")!x% Jj,, E@YWT!.rta@{j2"30|8Њ-ݏYgFcG8R!i).?˥Ůw( cA LA`q~9Cl]ڵkWZOS-MȧН5蟸ܶhY}X}F=҅WX'";KE6ؖ[$Fu,7‘g MU?z_%\gÏey5Ӕb)lXpGg)}X xG%<@e(?O&_;G{7;]ՈtP¥U5fQWKL~s"w7|"nf+& O{G)]I<{w1I3D^b v(~PLGP.k]!̗q{ҠMԔ;J5,I5 i/ (AVwD%c%"lZ\_ris›h89 {]A+43*crJV0&F Y .~.l/XF}R,aIN,\W}AYg3lY>D9++QZwgʾuĤ̨" $^@Z\$3,̂EԲϸ4".+ge*KIkqHdD0*㛪^됀 r8"£͒A,i)EvBSJi-e!R0X-ĥij lW@OMN:֮AB#L51k(. FT05}YK+/;N8}.-C|jOYA/HU=QMz+ӡa!vRJA9Ble+Rɵ "*7r8R=ƾ:4I$jKԬ7x'4G憐U+~mPextk FYōm (sP-z<_ *8+)Sd]ilQ wQdƥdɡNŀ(BႲ,A0ol\aNZRFxE 34 Wg`ݏ/zI @J_ `JNˑ`=? CYw'a0| 'KdyLIwU %?>J|yrM aRMqL*%BlM1$xO]#L7@c_4AH^gy=e]qo`4" g1dr\[G̵y1i*,!G3#O#͟wU9Z`urOӢ*E1P'lE[xvz^8jXw~4=3#{$Ym )ϕ/u C荱/tXljBmt݉[@L'#@TjՌ}47ِ$u3Ld]1C},Ld? WoMF^ttr,E#†-Vטa8'(z<%U&><^0ݤB*O.Fxz1$qw7ppp|3og=īYҼ`Lj5Xq3zj#~{*I,oܱ`-]{!Yv7e7.edz{IRǢݔ.cPm OJchgպ(]9px[^!%1[O/´\9+[&:^ʵxuh[&C(Տmh "SRg[幘~G06$7JO)8IG3=;+ѸB[BRX,ds=5lo~U,[[-)]][G^Ҧq}SW9ģN;u#?9G! h5h=$oDz6>=Vm:ӎ1{$s=_$̉ä4%쐍dk];ъaQ$0p̚6C磮1٭L4ga*[+kp82d jB)Xj yQ(30a:׍I3 &'~|#_9q!9«&&H. H UUrd @(ʴܗ /Â`]"3~ ~)nlCi #iyzPXi8`[1tC)>87ctaBnuC%/t<׹8N>8uzK+(^=H]ɳIBȖi6+% ȂTYP5gTQ6ɨJ2j}v rR!dڍQ8J뱇o+%t UI'%ǺqLLIf :htAX7<} <:Kx|ͻ.Tl(t^X沅 ,"}2q vo_@;d}q^\q-!ѡ@_ls b?/|fj L'?7%?@$VgW{ >TV&6CG4=)?MPijjN!TL___:O!_`J˨n@镦:`6L5! En4DӱfQklgm@}5U4t1UL@[(뷿q{ QG4oK H#K(Jm*%r$K+y!1y7 ׿^;]#f&[ug|Q#멺>2 K3vU_339-^p->W үx, /~ߔū+RޤUftw,^in]y=FZ?N]SPC0o~ڵGS-T*SCI3sx!Դ(]jN $}Bş"PI o9Fsb@jq -Z)cGPΜWJGI /s I8A/_KO=<@@sQ_Äจ/no;t\fMJ2 /[ӳR߇R;v媵ó&M}@c;YǣU#tVcQgG}ܸl*({ntyvt]cߦڇӓ?J^uSoվjɭUS;uPWO_:1IKgЎ(zsbf@rQTה54]( @u1h(z]n#:8Wi2)g;'vhXBUC{||l{ss1y"gyx Q}"gO<ͬ 2tFly<T 2R.h{(RMASڤ6 edBxqVC/M`EVV^8w"mf ]/I+D9br'8-&"H?URbIy*˰M3Bu6i@0A bpXo)DH4V>{yޟíYg Tڑ%Ʀ^7 2'{I/+G2-LmkԌ$:}alS1>s#=\6}1_mq]z3"ӹF1#u_29)}\UNVxfx̻> ٸirQd4{,Mu$A+ zCRԶC n3ޑMdL)#`<9czF݈6:O!ʵ0T OXj1mHV㊑cN#>A% TjGx&{ϗ󌾽kJ3זn=1P˪86gwLm,C cEaIK*l8-Sx]1ʜ5yZC/*^V/;7{o}1YY+TLPRIy"sYl(z2Yn:q޴j*-IЧ# 2'A?1cUm9vx^ӫ)dW&8K6f,OCnFM;Seaϝ_\f;unDț-K۫C뚲"Li((>|&f*CEJW͸aL%??䩎.Iq׳-=FViU^MiTgkW}:̱u^nz-R7i'6WMɸ_W޵^#FuD9bk'՘p$rvW'1-l]P uiq쨮 ;c۶-_ZF#(fzV!շ( + (w$ gay5ETMGc:by>-W9…ы$lIe 'o_ʭ6Vyoy0c?#{3. B" f@K4tO}v}N5#G0d HVYdDq(Vl0ؑ>hqMÏMN:e3Ox|d'teֶ0!40c zww;Ws6a'ƫV^~?hTH4K7r`H -@[6/(&IELl6ʴ c:(e'=!0̎k-#^?5eiL[gDJޡ ˉu$F,D.N֧É&r9ە{{c3$ &{d$~͆5.X!.5ZƶDmh-5MyS_} KCVǟPlC%Ѹh rDN ~ՙŴWwf 1>Fր[pGtj#ZD7wE0LtDq2=P:JiE6Z vC-0.yZ)[_@AO MM@VO,܏^ G6V͝//oE+)AhvZ܁Xhfho >E5@aWn-O>z٧}FTq%?xQ %H⨄<mS , Iē(ƶ 07T yjlNv΢Jth< <o$yE~Ȗ}}ELf:YCBwXt44O<|$VQ/Zv|pأz!P & xYilѨl%o6&RK0E*tc36WBt/FJL&Đr28YEʤ.Y#{k-%-`,Ʃpvf(s&ڞ9cKt1mOd"G)*)ĴGtqR^}tUE/Ō&,H&a [ڻt ^/Sbʒ=rTԼ?%=TFst[v)M*`e\ IzFzgW5YS#3ig}j?mS jϹrNz4tmGswyS֏Yg$bDkl<>C%YMɡeqTMAþԞEEMB9Ƕ4 3 N Gp+"W{|8[@F %vgd)ڝ@Wy wItzNl&Hc=H6* rqvI.ɫ M= Jo5C`ZY 88渧<<5%e֥<>xt< jȑhM;1 qz]J}IU)՞eYfH^gGjKua,";Ŷ`m~W|3)՚˃n?~㭩?F19A;Dd;URxhs[$w-}Y$]EêAGFFU7=T<8qŃXVo߽-˭V8Qd(-پaQP2QxZ=ĕ`CtWlc;:8yo·l7[Fv.$O 1M9&2 2^.v9`F'a]sEnWޘ_ꐠ]CPūrC+Fs.&OEGNXk:/;PN[>Jr-qNP@M7^jRJ]$SIQA1yomx[㕌[إk=omoel:4[)'hzkVKygz)$RÎR^Ýt cR{Q1,"B?@R$Ê1 Q4|!VA"p AtG%ǹ`hjAt]!w ^mahw[Kcp[g{X_=$[U57v`lJ~sXS40#%7쀮=E / (ȿ% |u5aw|GK _ yKhZv3e5`2{mQͥu<H+ Sq*UihDwYi`?yK ȥ8\9B=,7W ?Zȱ'-ƘY̊,t+YtX&W[,|5˶4,Yf~jWgX|U糧pJ佲5l|9ռ:ήܚ.|Mq3OqoO WZn $h9-`]-Ǒfs>-Yxrf 3+4r{a;G"5*rԸX М]rHC6t'n6IEh0N"a֌&L4jnEؽ'iƸ5,#JK]kJdw'ʸd4[SmlNM/mV1aLluhJ$? md;ο{+qg3X֓9;s%{MfO/KEeswnɥN#w &̹ +/釣0At2\겿'ۦ?"y,R`~+*%[_r^E#F4v)]"vW'WuqMf-#OP@cG2MS=Cee# UvAmUC,4ê4SP|*ML*0LZ+aA$3By`c6-״ؙZ!8!5A Ҹ#H1O| E'K8j1Rrl}GBG9A9n mSБGfT/!ci͔R=74u~1f`P/yF|>4_Z2-}oqEiwzmKrl9o^~>48#4uXVC3ȷR{28ݏRA xI(ټ&x٬Xg8KMpv}SLfYR' Wl-+4Ĝ~:^3nGt lv:>kf4>BTsFTD {}Ռu<c>2e݊VϿ5OߧЗGgg pWִ̬w:~J^M2KKfLeKBclq^@9Tvpd/y=~1}v4\&CdРY 6P46M˪RgJ-kY:3ĕ)MK?gUc=eʫ!};1Y*YY ] /o|hN%Z &a'…D$t\LGY ݎj25ݥ[ȝQbb*C&H+3,@d582:g{hkB&' EtL[?Dp)+iC9aYd꤭1[bǿ. ¸v Լ#x_yS5EyWHpB &ȿ_s3ipUv0~i`#ug^@V#- "넱^ ݍ04ah>:"XM KyA[H3/`9gj9%ю9Yk`T5O0z!}mp.Z}c4ێf8]]JUh)q1H3̎6/c%f~eW;˽ `JJ1kp2u_ݭ>ױGMQ ss.u S(ryLZ[_#Av{D4DL=\1TbZSLq#,5-mB nV_HۛS^1^f<"A؉~E}ޑ~WB AZD8bz|%d aո%N/r_pw] ]|=G]H ٚz2G\H+FGo^Fd߯HdzXX]z;FR)d͵, k! ڃ|H9cv}u"e6 ,3DoxHDFe$^_k_}GNpW-JwJ1wI+v ~^ek= ~YwEc7u HȘ4, DQ}!ȿfV!wGnC 0*Kްc›;(TґWH1E[L:XI+B ,zQ(xd86\!h@jh/cxKˣu!kYZ݂ӝ\\É,o{7C@mdLy*lvp}>M'B%#FB? %!J uϭapB͵q 1y3 +1.jעG~if`hh B-'I^W[պZԨ/+˗Ȩe:/ '֪䴊#W;;HA$>ͼ 6=$ϫsOCA<N s⃗ RYp=~Ϊ_ZQvx&y]A%5 G:km5BVs a{l\'m^Ϫq{)M1y,:=ڼ i4=8fL)~o`NJP{hrׁpH3W*!YƠ*U^@©,ZQ͞$\hP s[ .u Ylj uu_:. >[,<%cPTE1cOpIV|UWDF v~2p!,e1-+5Key/aB OSHMLUbq;ziߐ-wdGo1PZq2ўҽBESGٙzgwѐ[sR@;' ׏fURd*ì~f{6AVh$/MoQC#J!B`ɫyoI: seِT6'R=QRW "wx1\G w<XWs{!g5(^3Zlז!HƶU.z|u!x}M]X]_1fy1=HtG>a|a0ayO!#tn*_> YO`J. ?V&\Ga͏JȺ WI}ԥv>%ը.W]u)ѻ:$Ӄ u.Mu=κ]KQӗuI$Fo5{ ΐrYao3Ytz!s@{ ܅IҗJQD*Lv o[Gat0{;*SdQDF]GeYvT}Vo*TT OE) IzQRQR|5}2nj%E;iR0 `dS2 pǽTX/f1"iPs`,]h;7zmg[S&"Җ>"*x$&:wqdimT7 nS:P3͎lUrvcլf!4Bfẅ?,'׺ŒUE_& dx@\3+S޷iZIûWA~#݃YE?dR\o)򌸞S7ilMD'֍W6o6[QYN͚͛3{CV AsQ<ƍo͗1Ҧ߽*QiY>z!xOR)lZb(@:6o=6u$I5Dm"ְl87:$"e[dLhx# .׈o!s|p< )kܧRÆ>誰rT /H߹<Ժ#J)^ӮRFr;Dr9cy^d 幣\'$讄]jow?=ďQ@ށ!p!mVF7ANuks9M4trO?]$q˛ӯ_}9@Vq"uYD!^vnn#q|'GbW#jFG7'?Vh5lYUüp Zɬ#z4FJ-\>鑓wzԣۓTj`S~K9 |?ѠiF./F> x 4}. wT vuv|U6")钭h(:QCQ1J]yHbєC֊t ^+9zɌv{4Z23ն,dB3{XLʩL9<0f֎l3yk~[ܭdҚF-sz-5zuHzWDD=Vd+Y(}1G،N fu!j?1SAkC-aB`ixޢ_'CkwFE@Voյl$+cΆpVK\iۡrBeU=gѣAZ:| h%JR*aZJd12fy[6'/V"߁~T= $`;Մ Kilr4j)X;Q+r9JO,"իTWPEy||#Q+<5,޵"͑$^+Do~!GyFvq+si\F|W]SIL;jeLYUsޫ$ɖ܆)Mp |kG8| TVuo"^j_5YhW͉ WjnoG65'Fmw]5njծd*;vYxz]vuP}ֿs˺\^Y.=p\4VSl!tkCHr;ů}QI $!p;.Q*4,1li1.U\KZzwbx,ˆu{VmaDF.$ѭ+꽐)-:S3RF2_ӞP5VQ~JgīD|ⰬƐyŚ(E]߫Q^ D(+vų+DxrMZ'I]>YW8%D?mcF8ieW8I;FӷMwhRp&]xfDvc}sNp+v=F% vlԹFKT_OeT5sz MÕPjBȬqheVF]Q}C؇˹t^.~̰E8 xP_^ǔb>y2Z\-3م9V:/o ^aviˈ+T M & 8.6# D,CmN -Un? +l מ/xv} 9A৉DYeocZQ_=q*h9;tExB] ޱÆW<ݮx K(6-ΐ=p/v[PmZp&V׳%JuTb_ð|+n?b䔥Ԉ%d'cǟ+m1rPSG_A$v5D>*PT=AuT<1 خ9\ U@'S&8 =b@HR0T"c Nb.p@b1v/;XP*}KЇ{{ WDՠAFO lt-oEpoXӼč)wٝsx#E?gͿdr7F1ZCW P'KlCybkm ȖoDSn*!(u֣gyt"&F|Ri8!خtm׈pO&j:bN#OLYאY{t`f\P}ʊQ5xgvWej—+d+{U~ڭ%xfmIVjŔĊ/pY9{ ly #njRv**%\2i%)d|f=MF7d-!uXKb0Wtx72l\ 4Y0@?7Y%H+|0zeU +?^+F$ ~r،KlQvuq[ȖNX+@1/g2!^?KY#2 Đ| 2W+ A(s΋p`ay*|f7uR{K@5]:AS*Acϯ?ܳtpsx$WNRv,q{9vce HpQYv#Ѯ>};}6u6 z3|섊~Oy7s*b YU f*\;\uz>ynU\mSؕT@ +7@dq6 [^t7@蕻t]Z` XEjZ#uNU݋d],{!^d'IKTgb|/AnA 949!r aܿvZzx)"ViʃpRCc!E=E V=Ou_M=d#Yj?$q|5@FobP۵HLuNWDg>B Q,Ѝ1/4F_Qg(! El?s!Dz"ˆB$yvm 8y$g˞%tșdE! w nTho#]V4K\#/GX[:zvMik;pR- 1 l9 Ǥ3u1{(c%ToXDH${a_H/{h,>%B欱s e { /V}1Pzj^=((2,*_%-UY%IkoYUh(EصKA=K wE垠ytNB~YFTe7cfx+|ސV$݆Cq桮R?Չx.KQĤx@"Bq#gp:8')bŎ"O[R_ Kfi|c VeH2*Db+dUǚbss5pTY/Iu=`i%0\oAM}Z+9ۇ|],lh]( QYsfȲm$Ez•nY3xX9(~X?}몪g G=zXЈKf7=%9bOYeGm)pӜ,QQGYYN+#.I;kgi Nq\q^ua U's-"$#j71LwO R'kwu`E\V`)  S B*i Nb_O؝F8+ykМ\bq{vmV|?nK(ܟA$"G^Vv; w-(G%y6Nv V {2fF f昖L)u8. LA:\xL\9I]Pb.kJ9|cփ/th8`\'ng..XEDu⃠?A3 =hd\n~؃˵tŖs 0DbuYLƀ4u!Fʂe^2_?\5Fc6_p1gAeu9s=-CȗDD{u\}yѳqyNo,#DQp(VKNҥG63G^}]_Hv~ `4դUߥFx9fi 9vl;pB5.E\SemyCE+&"q䷺N_I{E *WPAspr󌗫8{p'"zGH<^9aDxzz;P 5G}n#ʻvREJI Θu>;c:aYTΩ͓'Z8r#Ff52rU0b4Ke(rCN=*PrZ%%[ mcFm(+&Veqf= J*O/%6B-H 1b~[{8Fǭ0zUZgwfPBTQAc{rnqHW(6IOw)xۑs5Ӯ1Bqͱ{Ya9pP9˽s;^Y@vPZ {L#<2?֤75pb_Nٞ5pwdxu듧X1N~_?Y^LuBFn]t:fR' a m[VF]^ds`t#eqAHd{ٟ |>}DѝW:7J ap*7+w+,z-Hζo;mXɞs "@i |-ܖDa b;߭8T-ś`>q4IΞF"»☪Y($DP^Qr+Z`SN%8?=eKIj굖Ț|1dKW^ͪ~|~vknVYG숧Wԯ1|#-6td/mKsJ_!'b;"ZݖTvU{ Bi Vz:̃V!ϓvL(ĦK"*Dcm#A ehɼwR%28S*1}5È/3}P S;nJsծ#ɍ[L>8gMAVf a^9MJ{95#d\ND\fxrgVSޝJDNsoekФj΀Avw&R W] %Oo' ˺EMs )â>`LoOT]pyhuf=Z~v+[{g_3c~ȬC&ְ*|h`Ac% -+M`hZJ[B7i84% @RWU#~O`?H:vrܻ"Ӄ!ҍ+vVu$Cj]<9(Or:Ж}Q=4ˁ"jѝ>-Axy] 8*1: ߫r-ww_Hl/=:P̸}=+f&eQ5x\'MՈt,)̧(ΡAדi/Д~v 4gѳЈˆE'Gw4~)>ө[S:I B·b?bNLu!EɱD-rejrt :t]{@S#C|xyk6j:ٽG z[[|ukV+<4gOvAE|4仐9;}ǚ6CЄe'ܞ폆| u_t#T /\E KRʿ cF;8FL.Yc;ihꜨ&͓Ä/ġގ' )Ҹ ٣xƣxad|yՈ&5aI'g!?Eã6( RC͐+p-__~ዠ?/o 4<)1[M}IOV i:3Qq}4it-)㋥pUNl5>*OmwRg ۻF|m0Nr,Pm+_8(4V?!SH*?o(?5n sjfI{qw{&4&X`=+T1VhJ AZ=@@un"GCde{B H%N>X*2Q27w55N1< {C3XgАQdTs2.?I_Oif%BGy;eaB_`QhLsoluIΦCp.FMm!׈f^kWT+ܣ0kVV˳O(= n=r(4Y"K(mAoh3Z3?|X''crч吠Zo,_W>0fJQJ<4+ӵAXή=DH@1C_H[| ZwUhLTޗzP=` kTLivim;`0xghphҤ<%RU\@6'r =S‡"yBljZwDZEW'?ɼws">e'8^T878d-%| 39 iv`?|/LZ9ײO:̔NKL9 m W94oҰhϯ5x\nFwV|]]>oQHDk>b {ֺ5gS)OUݵ)|բEuxҤg܈˷Qu&6kV`v23<D^ %%AXa$Rt/s]BɄVƪwNMˮ6fŘ,l(/ϕ M!?0F l:)1 bHzR}vrs5r 4;1ՋZ53`᤼(sЙžnz(lW|ܟF_Q##."l9,nj[☂^V.Odm5tJw`!@4bH\^؜}&:{i ];XuCY: lw8n6urN, NF M"x&~VN#Lk 0 7 ;/髷h S|222 24vJ2QmX!Ҳ 4H 5ϴO$90` kVjV_9}( vY-fF+eL}ȋW~pIxB$?bl=Yz"k" \f/ms]llu),،aJUU_l̻mN5YL&XW=:_we^G |s~IȢK1,i)O9=}&3t#sST'5L$pzz=,uGT6egG*:3߀1h5ת~8<᠅ҹBEC6u{/zİ`Y iyDXNIX#hRac[ѻV2$ltT_މ?f8.ʁ iEh c_XPgB&M 1l?>+-))-yTя?' n}#[$Hʵ_3q:LE^F vTL/_;A=Sw}đOd߾W#m5k@R:͗`i8-} eb\ffdz"7 ɖoFVC9!$NҨ |rJUf; z2Oq4ڬ'Mcf4s{jc75aMgSp`(Q~;$6%)!ɭ BW@SԮ"E}39qRu;϶ڎng҆=B1ii***-[y V|CfV=m17. ![ys[,U9\éY`H~w`\1]ֻ0α,Z*9_gOt!qkb`3͠H~l6dКUޣ75֓ ܏ODfRPTbvY{"S"uCNX]Ե,\g oAK2cx 0^m\Z7ID%V:АUIl3b\kr 8fUU-rF,Y2g]_ Yn %tk=I7J9iv m:yPA] K`啬|WSlSǕb%+Sx>sR-bcf9>tUjg?. L?'XGOVf " I ǻ1!6# /Ȓ;,^tfr0؉ T]I8/KB0?߈Pc5vmu,OfGwS Jލwۼ1-rI endstream endobj 229 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1194 0 R /Contents 231 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources 230 0 R /Type /Page >> endobj 230 0 obj << /ColorSpace << /Cs6 1230 0 R >> /Font << /TT4 1246 0 R /F1 409 0 R /F3 413 0 R /F4 416 0 R >> /ProcSet [ /PDF /Text ] /ExtGState << /GS1 1251 0 R /GS2 457 0 R >> >> endobj 231 0 obj << /Length 40594 /Filter /FlateDecode >> stream HWMWxGDp@ `0"GHʿ t0 !UpJF5U^}Lo.^5oR1v}0 )w9øx^7Ԯ&s+u[ﶋ۾{[ w?-{xݟZ,S' 7x]S!K|~mrk3lAe;Є7n9lio{sonnqrӨZ懻oawʖ;5 צ[URE׌ڷ[9z>Wul=7-s / GsO}bɯ5y=A eS@y?ڬz-gԹ?nݏt!!vip KM2qD_78fn5N=vd}qīW$8x*Oxȴ`Ϥi36{~RmRpN6#^_6&"ߓ _(~~(øqy}]LfM9g'j&N`ˇ2=g~LχkOqJ:΋PaIM8x0NS(ĩp fg53X7֩7KV.@k@ph rFC~f:emQK˿s%f7jحfZ`s斮 V-nvIJڪ&F l0< TvPq֜T))6W9T$g@0d0箷0Zw\ߗ*%>*@q~{] 1 wx8MoVn3[Zlyد|kLݏÄ~z5}$/qʹkux8P1wty0oZvFQtOoy {{yMBx'ʚy I䖟$6NS!/>|)[w!kAkUjːxN8zYUV72o/TmH}Tox$˽εeؾ[a3(xn<lj߭0~5{e罨.,zOI>=>,ld;$v ß%U AٜwVfxWೋw6fW/ [. o~2|g7k~E9~EYw2.lΘ1 {û#\̅uP.oҢ#0oE»EGNkՒGh"I\u2ʵ(ť_-]I'p,Vf~aRtqGy+"N˲9t.㝮?9rY-()Չ%k, ,\I 48p07ΒHX[B[Hч3ku 7ikəKL0ZE'U/QΦ5Jr]#T݁.!|JlIDSjֻS7΅fo774~]IplL'ZBex"YH,Qa:H1p'2Oxx)SCcb/C'ŦS{ M],˹ >T$%ɍ9XآUrhyq~E1 $x %J'=XEdك(f8~]QRs#zZ9)LH{;sf1ހ\r`3w[BSjn5QWq%z!'ƞQ9IxPh.jD_!_`VIC90CΈq&R>R$7E$p Z'Ϥ |Gx|GՐ/E %O \8,>x:qRiԊ(ExT"FbRΝ8{BJ?@NWrj HJwN> څ|bF*O*kځRf.,5+X44>jr|IEnA@ePbˢց@Ҫ9Pg%%L È5^cԓ鵇ex $EW/ ۏY[%V49V9q0( hVb\dr$kAbr!@+U#;|k2G,CjfqJ{ŔʼnkDk4I8J]ξى.,,IZs !C PD/UL!ǟ:)_h }[2TYnGl:G.$(*"QtjXڷ dl/u4Zp˕r袯xF1R0ņPJc^?h-BZJg:Q8r/#jua,[]CbچlM /+VYRY.#G&KeXD{` ?G S<04Hb6#>͓c,jEXK+2?5iW"/qIRau$ JF_%+%G^_Q_r`}@H*((迗-2_fJS.=sxxU@#!NXQ-}2" %J"m%NZU̪tZqWY9KN0"(J=OatakgB]z轹56/W ;^+.cOd;̘,c#苺4J&KH$q%c{MF+sy5F*f(KPIl]3UDTu`frӘb^vu9%A Lve>`bI*Da`.{Nx) +@]4$߰ub9xx}u8YZ`9S= zɱ"/Ee bZN4P՗$J9wBB䡔a׀gidbc**q]6C@斑&r'#4L{wXҏWH2(qeyB܊r3E"M$SާHfR"T 4A1D.eiHgm&h$ӈu5v\E!L wͦ2NUhw#N!zK>9^~ޟp`|N>m>0t wkq(٦SxL-\#7-ӝOn*. ؘl]E1{7rg 5\(vDL,\#D5%k^g"5vDs__Qd ^H/TOJ@.Q? ,3ADX/9I}DeA0O"pJj*mifϔ!R-#n籼 8pR QiB BiA/~${6/ELFo(.zAÅ״ܺ`fA#[fVt@R αy'< x~FcM<\f7ZWм z]kGl<8S8ɼbB͛KǞs!]Ua|M{Zi! w*€n!>*0qvC6Di"XӮn(:mvNn5('5CO&W*]th[9ɮU cyj㌚yyǤхtU.+*OQfҤsڙ~=jO'*"AU^!D/+oz/옧@xпzA5VaL\p`IW0Yt,W@6qGf\*̦t\gHh_c(ӫS*KugQuǻeYG>m5?xIPn~|v1n4IĩiV" `LwѾ6ЭòR7/:&B24 ˳\ys&G`80310y@RcBRjl@dDҀyEdA@rpBd$". Z"b!Uz"dl 7ٹ<f@Z8̘@FtE[ Е4]m $XR{"҈^;gv{),9K QZCЖdL!6;F`.F*PtݭhZpD,(Z1.c@TgbcLv[DXÉg3<ʽ&"q ?5^4v.f[Y*IÉjΉGlYQ$"ȷhNh BvlgV:b mt%S8'!8UŸ/FB9."]dFgc[PZtUO;kM^&b{ܛ !^?7#(VJx3'ܣ{{Fց--6S-j[QyZZ MYVP]-LpC["KT/@- .iL+3BI5o}3i2J#gg@C 867nhX{Ӳߊtsʤ@Zyn}S[yaO7GFiwh:6debiz\=/2y/2AR:]hY%MV\=5 ~[0=A|0=1z QЩռpEH7sq`lPVMgBH3= v<>N(X^b`>0]i̱5\vwfU^NAXSw;mk7Oҵ!(,]WeL4k=cMd+`alob1 G:k]D7G)6e1i؛^^8-rXڱk/ *竸ꐿ3Yt-hOef4f2 50~APS=;l2Y H{o UI]1Hވ Sג*ge6 T, #[5&} ۃqʿȒ)t9A/|`606 @wD0{%J"+_&`OwX ]0dħ/䎑p# ny Ӄ'ZCv E"[E+ 'Wp(HCUYxc||M+szt#'qG޶#NBR&od5ցT%VOߔ\|'R:@8K=e|00"o=c(-}OP* n"\v{t&$!f's߯#arl1=.ݐyLQvdz U5FF; ^F0g%XqGWՏrY(4պ4 ;[D%V10yBGIG_D~{pFW戽 DT:z[k* Wn3##"R(!צm^P1#Z_R,XtG^W%Lv*c7[dłV/\g@KT"`/˝mg[s'~ ӟ1s#fdy/C7l#ux-Xazsz!? X7`h+zc7=N'r{pfYoV>q{ŷ<_ZtgoD t| |M+t"C>G.4˂}aՃ +IT5pJ4jBuZ_Bݸf]|i v su=IN"dK~aɷXb`ˏ'2b]MB eXW9@KC~Ekn(yKD}-ޚmźꇊ1C5($ߕi7V7ʷX@'!9]KBXlmpff?i(mbp mh)LL/C8>cr]\1"( 6$.MNS^Tϭ2~E-Qsh`tm J×[|!m mѨerZe,orlY/H1)ٗu0C34 6 WTN,cO1rԆVrT=_X`jˇ~h||?zh"JVa cϚ 6c$hV^˷_o/7ϋlYֽNgAxǘG \亨n b~'p_ȧ)-CO{Du;oao|^α4䡂l}-ߦk FVW@rYbȆ Ԉ{ ؙƁ _E}֜Nƥ4ןh2ԅ˲Kn(hc:s+OWM5t&e2b9I1 [b yHI $Hd (  RFj 7F7E6)h4FӘ*\QɁIʭ,9s.M& zbʓO~J B_:nۆdCd$=M]N&q #ܥa[DLSRF=DelDxW]eLz[o{ѡ1 S>T݂.^XB]}€c_ח-=8ȍ}5X\pbpY2d.0[-TDf@cn]Y'!iE7 yUs72y_@0p#(*PXy&+^yߡW{;K?DҾݢn~CI/s;%W!+Pgg)2v0l(i׼aϬ.,t[T8 c2ɳKGC =C}~x!&6k{yJiO{Wy@C<4o/5P#q%˵a OFAh٥]_@jl(^:;JH4]bjZZnVCMѬma)Ú wНD,Af4;H˻q! ˱@ rHBn.Ւ̨$^oƕU N9닚kZSZBh$kk[R"|*GDF*[͋Wco/++JcA+gx*zg0*^&ÛH\ok=torάrׅlʨh}Q "do16Dqw)ԌD Ud{pX~$؅䖓Jr7إu3T P X`quHqMIuQd.3$k#N#=>}I,݅.+yԠa <`<=T˵9`B=kgfGB5P)Q*: iJ^5هTE>"U2 j pfi/uZ!ʾARMd'hg !7k5A&Rhv:z۸*<%znGoYF\5E F5NY#pD>^즿/RuB$mdiBGh%L`CdzgWbR=zPaBQR<[\<6k{vY!3ɑ_XE)bonHԡ[xr;kCѱCF6Tᵂ vrL[u[^ٲiLJ9OV P,,@Px}W~a7yFVu<LP#(Nӆ=u+>׍r3Z @JDJAQ hAժ %t4Gn]WQUUYEG01YH3~d9c8duɡGvePbfB\S%Y]p{j ⊺g ed0M3UPV *dTwPSSJwk&DrEeS]sR>%"$"UeOױdHPΑ2s'Q)GG;RB FV6ea`0\~CZPZRw9\4"bamxtE;XHKj4jw1O; GϷ6Jgu2fC8[Vr!_igw`3f峀 Th- AyW]O9UgcV$P"=hU-'b3RxBFc,3_.7)_YxE@e!H0oKGGHƛ6 BnI6YUlFKN2|׆ʗ۰q=<9)̋F+Ca:rp @ >/:V@ZRcA:R 9[A/bj%w3+>j(o)pG-d9:m׶$5G~{yH@s'HΤu}1ڞζv?UQW4f@WGm^/50붛'׬>!:MxQLÃdžɃǨ+9+f &tV"]; DpneY1ʱFirCpZj41YV-U̥N(Ov!réI:4d[NNuP4cǺCLG;p%qzuI֡6cϞXF϶ R)=0.A1#@eI[^v (\Q)f>d+АeOjբ-nZĂRE#׫oL:eѳkYɂ_Fp:64ǚ`( ;t= TmD۳ܵíF@3s(b/U\3`. ]&ZfgC?*حY3}"U=+`E$l6:K&wT߮(k6bs\ND'js}=G"KWZ'uUC[ åm+aft#3QTS4v8A")jD85hXK(9k5fF+y;.0/ӤE8Bj4rd$I@Ls叙nGE)*EI/0QɪM=)gWV- 9z'.tpKWvWz֎<\fدf@ߤr>q;ޏI'zc%t ʩV.{`*5Š6}lG.7i5XӴb2C- RMW\<@ k7h9V k~; ܲ~oa_-* ƪ*X cX~|a,ʚeR3 5ZX)n(ʙYx҆w#y hy,k`@oHϟ}۹|xraߓ\ g0*{[^r^.ѣ඾ A3_HjN9.n)Mc'-C>d+ #(xϣV{,DU\Mٝ+`1} S_AbG9u.|_#ߍ CC+wgp,lG.7kz,yW9S]&ī׭Zgt=ev^ty[9#,g795s~Jd Yr3u?Jݷh$$0x,Yj ;e#y㼎sʺHjtl`)sTN%-2dflM3U8i{]hsp@!+Y rM˒{Ů ]bϦaHJ$/=}~RcujghNqj=D箑7G'mpgk>T[Ƌҍ!f@c%֨Vz-(򱹨jΧT;P(g"+qZV0 KB#=E!R( CkS)zF0BRCԨ񊮜*5HXeR<ŠdqX+@/8l⸅:~Gqc" T|X1$GPkH+P>M&lM3腤Y&'E *ǼSj=QI;Zo>CBz-Zp }FyW&:Zb݂-gю2uv$2mqmUqH<"85C+ћ{/%PKQό!'b{]5ЫRN3b"S:DCZhh `2VMԴfvZtwpf^D, ~<駯$[¹-Bs>% ㊆b]W 7{hyFs9Ze?-#F[Mb -S-6Zi#?2iQ362,,S֫uE_6j_eTHTW,Uyu#4U;+qD,%XЅ2YYe|YwHfS Eh_lUꕍsv,i%TXgczzx*<Ju-"<H'LW,2(hXe5˖a5 %k"a ei@AzX:#-Sb)b%5iweVaS*`.Wi*HV] FVEIlDLVd*;q;؏~rCR5xM³Ok3ZdZN{V@|S }Q`0G00f_Q,3 |KHVڜ+-JXu:i*뎠l$q#jFMMpLkAq״y{Ÿ !;s)5\Yo 5†{w×lΊ0UՍ'_hJXcɑAƺ &YpxϷ$z>MWvgEvCtVHK,(.><\SS2rJ|AN !Tdu ΜyEo~S#=C"9uF&4u(5j|? CnZ߻t { vA،MLSFsoK>^#7k8( -#D'bPȟӓB_eEEW}/kt@s5̔mE6̻Tn\$8o!ɵs<#MĖ%;R\azUc-!`Ґ(~ 婇%V."X>/3'hݫ> > NI\4A7C1sBTs1L[^Fl˲UO3(W|H74{5~<'zJ`|U?5 1y9V Iڙyr,eff]<榪J"ͩ@w] 'ZU IOE=ȡ͇i@5FQ5Fu-n'2| WmEA;ј=lLBT) ^@x:ιB{Ch^[(/c,a{SM:N&ypwԫ$77W.T7s=@\̟$^Y9*JZ|z|qe@mcf͑9Ze5> N54dFm9ɟ1jE# Db4B).U]9*Y"$s'xP7v9-ND5 GѫBjd&>+4YN\[V1wjjAIC+$&dV큾idS-ԅi"-y~"jr@p= 4 s0VSAm^C"`E0d iY/# p۲k/S0xCO:Wޒ9 >1S̪%Ly9͠ǐHo0D~PP ZNQB`HQs.j$^^u)34?d_)]+{T' ~P6fojH&XƩ<;j6)\ u/88\vQ|fO!ӏCĎfϗz1[KdQ凧D|^uՉ4hAڈ~ǂ KDaV9Ch@qQKq}S3 \=OFf"P R\^#ВM 5z+ sG@p\Ox?N{|ToZO^t:UGV(6 4\?|#4|mm;3- Y_H{/*W}{|D|Ҋxܞ1r|gB3@y$ȈvjAy6zcst|'F ոYwN+c|P{.xaj(WoCնJŽx<`+mLUԣjOC]jv&5fO؊#~eȖi;g7]'A”ә#%J\~OUو.].pqIF[;Mbl姒?,:¯1C @ mPIO.SNTP%&X$(βjpᓡZ=NNa͕+@Iyh>n6u$BD\ŤZ+;ArzGA#YI7dTlF ٴv-P];&Q}?|^q3tT96E8=L3Ed6'dیңiZΟ43훉636LGcCўiq}2ѪJqUvnS K[YI"g '╌" 8J6nG%Ģo%f2ˌTu)H K@ ՇwTGJKDB$dj2<` %:OdRa aq zLK:#TGڳYJi@r3emăoOc B #$%AXdB ^%[)"3ǝ{ Hf HCA~ӻȖA80M'\:^CіFYLd:O3e8S051fr<(H) >/qKpšd#YMN뒯YR 5DP>zkؔ>J۔3Ixvmm1_1l`n5^HA c س->[wg iǏ! z#5 I41"$MvM{_5!vRc{D8ItG\{E(d#EF3ACKܜ)K0[hk{rN4/12XD@ӤphaE_^hh) &/YER y σ M'@>}mRYm ;b=sQn1n2yU1#u2 M NJD۶aJJ[?dVnk4kbzW/mu,&rMzQAі]3RdK[BN9L#ޝS[/-rK"9ڡ=ӃnwfJ-E8Un\Jz"|ÙNu :Kluc5 &fBjV>K$0)O)xt)@)裿CWzFEEAZt{ CGvɓ.?E #^K\qTK^~"RoL)C^Z/>ItJMr{w{t,K_4Ar=b3L7+ @W%{X'b€s BE{7 dޗ_r ]HO,νyGH>{ۯr UdxbT㑨*=RcOb#P|-|f:!t/e)kE0-v(r ^x.4ԱjCFp%U;;Bc#=XRd-b+䈹x}iq$1sjlgU3N\A pMU\~0id峳:tmƯlő@붤{JF! -f>+ ?89vwfo?=_&7D_><›ڻqjq&J/6Cϸ#hIV:m͢Kv 5ϑH„TSB >"$lGM(S7h:Q^J o!TA<.`?2Gpv{-roNQڇ`z0a;R\%ȤPv,Cnv 6WwsVce-){ "O_PMe\=%DsQ~Tv0, 4I. =st9haiDjz(~rj-tF5kl:jr٩lmOS>)$_#9=SO\>)]:g@D|NJnGnFR;%c$nrnL"e]8\[,؆)|NtUC-F(W#a1+?H~1̓|/5[+ 's<4aZ7ݪݓZW G23=GWU2=Ś$Bh$VFRPsNmzw˛bP ridPQm+տzۚ?}C ]u ;) 9?go'XbH:#8&=i ?#p Z;1݆<}]Ռy0566I?&V/QF`ܬ`~V)JpjyCzҏg"s }xzv> L!̑#K )%ry @3# @ՌQ(݃m*HsI`UwĨwgmkt5Ƽ2zаWc ruGAf"K[~DSb!OtXmAcl 5]tC婇f='. d;m%K.sѴ˨K(9ѝ='%lO̴C5$:w*"6Ti{_~SLt&twjy83{znYNŢkd%("Q)! V 6iC .>{Pv@7̪׆4{ѿ.D}(@bh>HbyHi{pv^v2K1,62_ウj fΫ'kUhK5ψAxjiǕgsuzV]=\XX=: UPK~j{ qIuk7ֿِfӁi5#לЋMN5=:D T_'RvJL^ H5oyp,ł"Y`癝ilTv܏ =QVVf(ecKZ_2 z/i:[4R ROa=<- tZ>IQ0XaU2 {jaiy;.+@g<<ۤ [fQg'Xj/ZB(^G=[&LŕPxH29!{âXy^WBJ5"//ye:rXࡺ:~p1ʹ9nēG7Q2 { C4wn'?I[2$g Y P6}1E|e܎ 2L׾B(}JO{ @Kjd(i#/iIV:3C$OA(0H {c'fÞ5=Sl%T(vJ.w4œ'a)e? /v<:1bcy@~B-  @B5*Mc_OW;?R-*9,ϒ~0TJ5蕮^!>3}2Ṫ`7OƫgOc(j~oժ]2!sxp)ЌYW&-+ʳMo*5c>bV|z5+B| w9=^my$=Ԙ* riW6QluGZɨ1BVmBz7Nvߪ <锥"¼.`Tɻ1J4oڛ&J> kFy$8\jH_l;3xt#KlkU8qɕdI T w3C౼ g*z43g:\7i yKWu.ce̾fu͖lg.Ay'F4?u̩tS  w%'a,c9]nHSz$nFqoJ`ulN: Lo$$]LK0d-+y`nWf"¥7%|22sXQ#Ţ;hA# i > ϻI Yw]+H#BnFԌ;jP`&uPEy3#ܻFv@\MƖSn/Zu͘r!HU1c9DbI.>(5= :jWTǫS+DŻOB3X[c\Qy%NW zԦzˉ #o`QΈgp2C$<CBP狰)/*D/-S[r\ Jt6"wGc3QD_1>gb.i ;(K7rsWh͌TYUT ml\Vs{J! s\D]^½C W{w-WØ>6+-?^7^l+d3L%ndkl).c:"LǖuL.vc,J0FP@'h(P %'8yVhh$(iSK3 y|Qm*LutaT+F1rQmRvYژAkNmt6_t!iɕ_E4Adp]']̖_EO31Pvt5KtΝc$&΁{F칗Ğb;!$}@9뢳f \Wpt][_d.!A?j`Wٶ; u!Q5!Z?_aѭK~VAxޫ9b,`FZ_d<1B=pg:TEFЗBb-f Ήl>IOoagtaV|(G4P[MZB *b7^74;t?qz:\!xP0c>ġ 33T{v3ͣOz!{U5`K!G7|} }s=.g_^[`DyCM3.[ߐU7Tj~$ny<=4b ?X/_e UB5tUC?Nkp?`ܽyef)@Sv$W [z@:23(RՕ}+uAb7 [K' `W^}HtwW1 iv9vlˠZ%QCζî㎗Oo &χOFL(>Ak=,Su/8- ۊ swRM_9i9s]\> ^KYѻ b7t#dӲT-`Aˉ禒MH6ѕ H ]ƪlUqYSvaOy -ĞT' ӄlnB}u4gbZƏ]Pwq $r2v%"Ja]fV[(pPe zǛ2i\/ ;]rjZ|MEȋwOM9ɉœ=O!L2j]_' pZA<.T/Epn&Ҍ(MG/~M9(=h?wwyHa\`.u3x-7,Ԧf bx1 =@vtBT~,;x/Ъi EU}Չ?2 peAXPP1 cp).ԪݷeҭeY ӉS}fS,avѯVteE!|ƚns{x#~C *(# ,ptVhHC}PGՍŶBLj8 j~O9e{=ḧ́ >7jtk9;#O0ޡIP|,%WwzzaTatW'!`Irp]0ڲݶ6J3fκޅ"8Fjh`^b?Ċ) Edi$ oAh<fV;͹·<[whUx:{vz|+)elud{q*3kH+UôtT7~!%( UaO(d! B*(}(ҭ~/<= "jjړ; \ɩWԖ FujT l~&vԼ}Be/&o\\ юKJ:QXHr9_"OCOilv Ҥh6=gD7+W6򋇯2L v]7XT={ϲmg[~/ћ=f̂ꌱZ^.4@qr6<`RÙ'RAY3"K=0/ Nr)b33>tYڕk3y1w|z!JVCI1 m[kl-ajH<ѫZ_l7ߚ X<m}ryVIa||c7ToW_ CO%!4q0<$lf`kޅՍ: *!?t)%fOkIGum' XV`] oRS^e;H"ikifh =D.(qKb)`<*D*5+t엉sE| ِ=[ҜnA(}}+~44UהH&e/5*>N8V5YLs XfO0^.`sw'dtqx\z2q"5/KCcO;bf(̶2+e=͒y勞GA$i[6,XLqj26.hC$=:,&0`3[lj/1|*ؘbyVM?́W2JLϯ1/?,$w=4Ϣi?}YT]_c|ON24\^ӣ|^}O{~\DW?HaTB"p pD SB,&W{E(Fcgݮ/V;Ч&~&#yHvMOsWo(dn@h$兕47 ݶ!%AR6x@=}R?+F*K'`;,\,{hwe+miݚhW}YV_xc'8Yo\v'xYwj"t)-8rmpuU1F$]㈝w!ZyCk 06`OK[=VW,`sixf8H*ʍ?XN/V5Z=_'xRPm򸀉zSPD3csw@ 58 n}қY5(#ڙ:P, ǙTvw96'90?uvG*)N=u}Yu5#A:.T=pz8xhк$Zϔ mJ+p\#cڭԭ*d";'i4ƜiG,&24a*/[DE` _´yqRi^NŬ;/9V`suT'}PhWMeQ:.{Hh;O+Ƭ t*zn[XqGUыac.84>%bX1 +-@uĎv^}U :hyλnwz [>CGkfZvJ*AUuz@f"Q*d2<Qod+> C\\̮˺<JP&ѿ 6fHr&k_K|W}Un# ! {s0qZRL'PtD`3Fؑ4D#F ̭މ+f_?m]i|WO^U[a\#?e1ノn.1i8g8ߴ/R @ ',OCYA΁a XP޴"RJ*;h)vX5.5 c@hl;rWb(7fV8F0``v eb+}dXqnRnA͎eGK'.$)\Х6eNݡJ^eUegh}O  irA2sv簷3RHfQ.)R j=v&)"5xMF\Ѣ06B7kT[^RؽDeaE%?9CġͰk(Vbl4ʜ̌fRws$xсx^" #[FLV[(J*ͺRuㅚ 6Ϩ=]]IF|*_(ٌ"(W )kѶge0gJ \̗CfʾSd_\܊#AR"(athĈ244p͈e;št;feOW6ODZVW6ds'm zwrjeGmoPzj6!ے_v9nvPxFǃTv%B5TkgCJ<'!daȱ3CFL"C+},oxl<.O,TՆdA$J_-ٱi"zr+%0ց1ٕ2668;N]q.FSX .W,Je_,>g;(jnzbe{o~xeWOv}@ ZA b;P3?Zv b/A;E\bY.={N8;P]o< ' ޟ(^yA!n%;̦fsA[ 8#-iăAS5p ҼGi%Z|]= OCg\WI ' 1 =s9EvUE\dt~|<*_3-~U@q/=5 A0Č$n} R JJ0G: :jDpa)>ÕGmM*Rf`RMDZk+HbL8SJu 1uWKbNimRq(yn-=y6q `L+6%&HaW`شcUiaQUA*BWZ܃JgU_G{MK7C+[XsC+0rEǬáһ$I9uT`Q%Owಊ'Lu*{TLQZ㈡EJuQ0 DS~1"Lg;Upu" cʻq"FXo?)Zc2BF{+s>=qor}˂ NM !P)^~c3+t$su5~P,2p9Tj.}p@Y I-a"p :a(''h;G y֢cyEw: K-qnFzEbN`kZ1wi@I<~ ?9XvLa C+[1g>{؝_š $?T&4LZd~1.c%[⽷_ /Y5>G/H"NjNH}he\))u%=ՔVGu덟û?ANRMU|PE'UnPyŴxD(9U5յ\1/R;@,Bvx؞#i3!,j/$Q^j-WPHA}A{8{}2My\;k7{,̔5M'f!Zal5 fB-F= BSJ}ǟ&|a6~62IG+9)-,zfٜ%EG@v8B7˿LVrTKb%.irTZiWnSY4娶`/}3)׈^weFy6ܩC!ݞnIXjnW<[:{T.n0±WWaXbEںs'JW;s\Ҁ|Zh>i: wE[y>Zr ԿɃBykoCwAPY[Zu'qiEsԔ7g2<s‰YyA?N 9}`u ? hDT@ƽ-y!y^K|;Ǐ)f7hrKWgCGJ@ܦL’rc:QYRE"9"I@9'vpi B|8 r3/S);¿9jVۿRec{Veiκ;.9^w뜬-u# ^)u<6^3뾁y^h`ENR*?%*_X2wQXG(lw&X2(4IYxT n Ⱦb-=V-]ԶR=׳^aBࠥ}T,MA}! d}hEʖ5 {:\OFyؕ$mU̬4V,y4󼼲XGĕe7ÖT,4U߰W%8޾_[ywQ+W>Ry8YP{_\Ee+"%R,c2)釬]3 p_P}ҿ[ų=s %6ᕂ8~?@Z~'EDx=W)MTpӹ .K)=8LJKV5Vdx剋Q>3H\d>, Ojvû4U_DuֽŒ!T&S Q% ZJX%4ĵ!i)6&[15#@dk,o}EWmF,XiZ~ )gT5اŬޕJ!RyfS Vx~jϹsm;-DZx'K8;*n5oS+:bqvê:l%w諿EF](sy<g{k]}/Ea;szg&2rq?J/ZҎn[^qV8N W *5?I6tf]Q&%v6|)V'eZ8E[ @alyi'ixCx) au^dS2\i|?gby%7#i&DLŽxT|ĭ䔰;WP"A<b~J@ÍS+oi!̎)7LafWzr(|ds@kE:,FbIxp/DŽm7Q4]n9(sp'fZ7iFB*B ?!IQOs8w 4pU)JP霧ydp 4ޏ-K͋Rf-$Ȅ FCT8-ehyr4?d%GA$rªz /dC*gQXڲ cCUG#g1耗mu]LSx%ZUPŤ6jKQmuZ[mǎ=9+Y&[ }q(o᐀p/0LƉiIO\sYin{V{[8tFjPѕrvwyDhйx'hҩ(P~q?OOSp "M/|]y{XO#A*ub݂bzZG%ʆ*Q|TaE×A"%iBfڍA1əÁᨺd8sgNuS+Ew4Ϗ8#PyEF_ɱ~>ި_*FڅZȽGиk J72Q WD4Ѣܤ]-j+C|x[c~9M,ιY( {i]@_W/ʔ1QDGtOP^/\Uϣ"F h_Q"&*5?4SsQa'(~뻃_fd">Kvnӆ_'JƯo{~EUzR=V[<_[?X~A?3cT]}z(<+'t]78~5ʢt%?ZB}KqݰTnvƥƈWܢم ^1WթDRY1<!]^ekbF}bWJF,(R)F++ݞH.ԾɞtlގB`V]Auch$ԶVvG}Ą{ixQjg`.=aag^=vGQ^k"$)*OatR5kcr,~U:_]1m|\sζ>5fdUqp̸0Z5FCi)"%_ oO׶Fv4 NDM/ף[ZB.wS%c~=GSqNum9uX tx?v4BW齘F#Xۮ{= d\&Zqo1Fy+l+5ڡZ둙(~NkR"Ტ5-+C[nR:*au&ԚYC;xJFѲ^'=]ZC0Ҭ=)qiSGB륳Z"Gz1SchE-4hbwc?bqqc KwۈL.4nA.52'AUپ/6׆}-r(f3Mt`ߎudcjjwhپZ魅(rB݄V緇f*Ld\Ǫxc*5~GB9V<ѥʛG)Xzx%׽bguaQn/n=O,MGFYA 6gB]ehZs+DW&:Qb\\m%H[wI:usL 'F J2CheA*RICH]v>rt#Փ> ]tmkX6S}_-}+v첽ٞn>xb8;40*%ycs$[_;Ua;FΚkG|PAj[-C^#jh:OT \=2;b&U>"$XADTfaA[*3L,7׏پ(^ Oˎm>=rE-"m78dqGzrz8@iӚ *NA$m'-smU؃{3-2-hR,ad4`I1#r^8 ;''e|f(%耾bM8ٹEhDZhmU즾%s֏! 9]3܇ X~^݂GFJDz>xRIJMK/*$]\LZنNU{aO+'13hS'ڕFG3@ߙކ΀mUH<fe{ y{Z@JH+ $#~ %Be6gͣ; G}7nY9KP~dOlEyAxhoZ[i""'hxt!7]\+͓e @4έꩇa<+&X$!\yN֖[%'R #Ƶ"N)ģRReR:-&9[S{Aԧ9 s%}@ I|DQ&%(_݂|v%sd/S-KxHrt j"D@L("xc Eg*ܾuEH=n=UW+dyg=cwt񟝑0zD^ipZy8nOWE4/ oOW@MmLm+[Ŏ*v KhjL-s0̕S6[-68~*'Bb د&/t&,ܜ~']DY]RR( 5."SϮulBJ7P|]ָ|niL@XU|J[r+*Sv,ψ{ FOX+cZH",3ސoM&,$ ͻޅDJ \ ɸA?*G{q5;R;)jO4?ljmj-vVg彣&4tVO,« h_ͩo4p"E&4wI:N}ژHy(Q4jW-go34ܞիJ5Q#^t1!ޑdpf{WJr% ¶t96Lv;I84qUMǂ7i:=23_QȤ7)L2ޫS. U!Ul^u<<$W!n"`蜜&1H8ٌwH&5Ȏw.X4*2.",+G*[KqK&4Ȧ֫4"2J=y5\aRϰmVly烒u9$H|fؙ,!` f[].iJtezqI-Jk&+:=s^}S+OF{xH( ыwx!t-܈QCv qECO~Ӷjϓtk$6d:v~_0+_:SN˃InWhN<\wvn)N{G:Up '`8o"jY>0i.\G\4^9DK\>Rk5H/r:+CSqʾڨpgaߐ}o r#貟'T-l /aj:RR3)_'{yOY8XIg5~孏ujVm:gw N6ZJUfe1u:bmxAJyAM=I'f`_ѵ箝M-H">wR8eʹaT>%6C +p542RU}H8s$6%cO1ǟ/$heÞs)Hًʮ Ƒl?3ݟIčۧVtIqm?\dk8ʺD'=9M IS[]l{jhbBV)K{',o/CP9i?X.T @NUBЎK͓"mȎltG(:#ioެ{=RuQ ă2{\A{cqpS!sUv2R a1F)\`0!%KdZ= 27&<ኂy2k<2$_#ԥ.lcVX^Cb6&!qZ0( T.$PX#P:M&`X{rp QP+EAmitӇV@'z;j>]= M«4D^r @^!mAo—+,[x4mvoӇ%KA<]iҠ'JKj[d/z`ˉ+H^D , BfLK%,,FM @/O8 $T&ē2n+^t$jk&֢|sajA{a˩z V JP5iz'oތY7|? qzKjMz_}5z[kn~H if2nMC_ &R8)&cdYl WX ϼLM 7c=bX.6b{梛92~,47Cׅ,:W! XQ֠D wM0..6:F}aށ0/@C:$zH!P Ȼ3ݝ."ǖ+_r() xR7ݲpO,yϙ 5eXtN}|5$*Hd]u Zb*/~X޶ t endstream endobj 232 0 obj << /CropBox [ 51 98 561 694 ] /Annots [ 233 0 R ] /Parent 1194 0 R /Contents 234 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS2 1231 0 R /CS3 1230 0 R /CS0 1231 0 R /CS1 1230 0 R /Cs6 1230 0 R >> /ExtGState << /GS16 1251 0 R /GS17 236 0 R /GS18 237 0 R /GS19 238 0 R /GS20 239 0 R /GS21 240 0 R /GS22 241 0 R /GS23 242 0 R /GS24 1252 0 R /GS25 243 0 R /GS26 244 0 R /GS27 245 0 R /GS28 246 0 R /GS29 247 0 R /GS30 248 0 R /GS31 249 0 R >> /Font << /TT4 1246 0 R /TT5 403 0 R /TT6 459 0 R /TT7 400 0 R /T1_2 461 0 R /T1_3 416 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 233 0 obj << /Rect [ 139.8 336.17999 148.56 403.25999 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (M5.9.56192.L2.o.Installation.Location) /Type /Annot >> endobj 234 0 obj << /Filter /FlateDecode /Length 235 0 R >> stream HWMFWQڊ&8RqmG=ة-gH{h6Iigwkj(Dh~aN-^y=C>:u-^|gZh³VXWuT~afbʨ͇xVJQU𶲍6TMTҘwxqcl*4tT.rxq{Tt`ԵROaa48bPElatҕR:]H; *tUFW>6__5PfMԮ (_fqpg99aJnrjM#?tSfԺ]ˊ(+fUMbӹݷj{Tw]{8aٯzu{[Lv,5WLsN$BO6 xQ4//!tJ.ͽ3B]NICb4l,~NLPHfGBY 4܄ (F c4l"0 dA]m]GE9wz֡sf-O+?fzz]~CPt נVrZG rGO=?%Tqt<_Z դ|m,0DA~)Y>!fȿk[ۥ{51@4C#Ap$VbA]q[L toR[ʫ[?(rkCOi%e40*-dfE ԃw:(AYq&j x{Ѩ&=ڔ0cw*Fyd"rߵ ۯ`5Q-_nVa\N^{#?j;ZnxU_BT/s,$.d,y:F{coVKV)=va50a)WKd;0ہ/|X[4PPݒ͵g.{ ێQ{>\M(ʯO(g+p.[gG 3iE좢ԛ~i(1PrUr(+ $BY;'ؒ~j푛n%Ck9ysу5c1E]= w8:XWwˠvxL3D/9T^NG\كA0 T%G(&ڠѝA.9ê9'T vIQ_Bv3ׅw!`2{^Ss_2) QƤ1 @[GFr$$+ [¡fe48 Y*4cփ NWF4EN'ΝsYΟX Y@nmd8ya qs6>eu"1丹aOV 3>46E$+"6Fs:բh%b8  R.TX$) `'-&92m2Ê 5g4*IV@+V4~>v$瘌Uh$uiBNw_0jAOBv$;p\fH\_uh]J ƉDt1o0w{òGdž6qr#Gh([OvJF4 ;z "i±5~huii / j- 'R D4%Cɢ fK̩26h99Fe خ,[V\׿0Yۧ:o%ن2ok/)a+Ξ'sDJp@Dt>a 9La@ +Y Νcg Rx%[6@ ofJ ך"=n+"3K_Hp]MHn4_1 ^~@78Fx`+:fă\;lakMfI87xK@TwVˏZ7pC4Í.+QubWa'N79|֜ӃPiw@.Ĉ:e16`m>#o7aW?"~g/"Rb)x,oLa,eG r7zDq~{G\ A4y{\25<! A}3zULfT:x{|?(؛0Fm7^E'eOB,J$ fu"'ir{rMSZ\!u;pB&=,Gn% %nYw(R G_)Ϯ-nt!O&'ɨGGQj9;P :M(D*'x`S_<_ H 9[" |t7aO8q)mT/aȀ5fګ(L<ʍA&dQq#4ƶ27tQ";aAȉ2S, Q weYnE\"B]WQjڢ$ʹaDmFAtE9Hz" 3=HfJF,īensRYvM< pTe""H4BMS~[r 7B(wn5ݒ}.w?hxII5E'.YBdt&\Zz(R. {#E8s N!r9Ƚ[9eqi}-џQHA1.a!'c?9T "gi[ ߢ~Hw=sÞMI q2ȧ7HU-E@xob}Di8h~$ x͚73,*>lݯnQ9,Mg9P(]DDJd1 7"üAJ%"bϙ d1&['2$7E֣g1 -d@H)"D|1geYT| p;Hl HYYCȁK7 jv9`jP +a@r* ~l6b;Q@*d95D`XN߀$,nrSrLtE>#r)rQﰰ d3 KY;0d ,":.wMu|j4""#I F{IbrU1`e1['",*&AK]*'ae5UQ%_ U1ߌq0։ K|-\ RyD |44%250u ]گ1Q0$kN$"F|~ݹ2Br"J BC V |SQ&o%DvNSd2B@74I`Q)Tci@vOi2 1-Q$eaUv2,*Vs9+5XKroڤ%2,WA@G4} +3:R mn%wY_GgկwRb/ߊ/}Ǽ7JU?.9=;n{S8H%Mj/ŠFq{\Y| eLWGc9} vY}Rq߉|wJUO$&*3PG@kz-e }kW/xͽ!(+ScA+/v9 я+!(J<*G].&{ Aɛ֒E^5 L=y#nqwswOrl便yAFNqǬ׸\1{ن-Y1qfb;\H/\7rۅ}/WB_)9xxѓӽ?*`񸊍'&cϲAܮN1!k9Q7*W:?gaVl'ݽs~ >mJ(dZVh#7v3|̆o]>A>5jV|ǜ4D,#pSr3ˇ6g] [W [yw+TӬרJAYڋFb+ec?j-Š>O|=p# =9!gޕ9{wΩz(0U^#H]sqQngCڽJz;7rv!.FieFdߛfc8ɰ|R$Y!IcbzlGxߡqCt3,lׄ'{BLte}8ud"=ŰsmRpW)>K'SqD6wz׿ &{{ `|yDQt 07.sDB49F^1?7n5؟ :LlmWg5={SDN|ǃfufoװxW i|KvB~?%7νZ[_J^BF9~'8$@0ϥH}N !3i\25sMOٶhk@ $=zߴFsuXF'U G:?A:nsJ04. , /!cw>$jhW]1] lOQb1Jl$+ɂQBڭB阬a&O˞Zܪ67eT|eK6vl]rxs8 +`UP`uMY ԋȨ3" :iMk Ð&%oR㙥d&2ݰ{/Uv%4ZSnFſC*Rr(&=:"3E9hQd=57)*j9gG4p%.Joh08Syw?Tw䘇]1[K#mC0#Gˁsۺ4uxn.1͕:}gym!H?-2ҩܬG@p~Jb R kj ~.Ub/\ mpW[Q[W*-܃_^!,p,NtnAlY_p,);1lQd8mlaM٢RYd.1>6Ⲿ⻘`afdyAI6 MN={പ \L| %(񳛬.XmrV1$j5c[c4|P Nވe[U_ۆݍW'dz4g%/Hd͂lD3d%<w"^Ĕ"†ypq~84!G¡>Zv$Gv8};]?4g|TX۔i{b&^SfyŖ޶*Aji1#SQ;^[V5.n\U7LH:C%i ,Ɇ-ctAX"i]X , "a[ QWnZ"GyDdN@wݮD"dZ ƑiUz9u14b=r@HCSiCP9 cVWC. nIt#&&x6ޅ"}vB#7ByA\~O8pΫ.l6)1֦RQ۳jɜߎw -qCLp:EԊ#:i;)"EUV[.)BRn%Okg,yM|Fʄ㸕xLA@–mk )!稓[qOqQ67alCHf9fy|u!m Hx0of́Ct$l'/N+h|z?ma9Q/4 1F%jDn@G@ݺ#_q҂A/"EAӊKKS=3g^HdO&Lu14\/>igܐe"";2-D<&zA.}'9 օ'uB.Y5:%I*.c3,ߜ!>Lnr9ց@zMHs(-(rw5:]wa&Rzs$!Y Ay>@&;uqd' X莻κEY˸.3+u/7I>'l=hQ 0qKI'|}ѓ7gӞH 9}2OeS R%&e+LjA7ql w])gdYEt<_~+`~$X=J!_n#~8TpqqW._=<ӈsH⇧w6Nw01 #^.xO_w/|:t|]}?< ;dL}0>{<>1矏g.d1OBKrkI(V}6`'ѺZ#}sO<}z͵ӵ 9hxY?R=Zqj9&2ŧKjnu0H:'` I&CYOY1a:Ta ,ogNzv@qys!Q.I PEprB\ʌTy/2D- r!n hwIFPj\yؐ{wryˑi!Iq7%QjOқTvH܎gLw!R^7tI :"Hu]ul&$QFcջ|.}QdXU#d}en83uhdk✠F49>p敡SY UPi&[I:>["6}r]׮%!j`H$O$%7%-(*e%;8spxD/*PWlJ$ "SG4 z Pn]25הŜ> .U.#2qsǴ1Ea\bo%t[.1/AAo3{=5$Dq{SAN6WĕcU rj|ʚ^rpVTC Y B뜵Sj!V93:6C,/Y !ZZ#t#F_Q֘>uΉ/'2īƯHv"3f,,Q{\ &CwQN@#x5q,.˦g:2Qu;oPn%1mZ@)^RshrԷf0Y!zԖ%U`<9[.`Nr[V"IQurvр$ZPj@R3ـX3݈Pm@j@+gB 1EH2/xaٲDG{S5ֽNH[5F$@}pɣ-0);M|vFK*HR'])HxaP'v{<- V|}N AF(?g]Mnc"A ܨjZ+DPj1L 5w*e]/1xTbJQZ1 b*yì4?qEe^rEN7!hjԘSzUzpc7ٚͰ7yv2o8h,ub13Dkdܹg؟L@IjhGWŝHƦ=mD9m(7K^¢i# Jt\Z1:2QȖרS8m"rk[޹QA+I2nB ZDD}7<1КFMƗD,5z5Jc@fCK QۍUx6ꤰ#1,W2jM$bF,nFjdVK;(6oXK RnZi,5bJƹ3vZ#P*ÌJZR XfL5+i6&Ԫ&Ƙ\FGZ"D #?`\B$j,xojF#KId :+VxOh$?:q&2Rm"~4K /QFw9.hTß)2Bo"a͗S+f{(yqdRdGKc=tP]2lj@[X`<GFJ@ٯv]r#+d.`ow ttYl6 !J tO}:ca=UGbeN 2f$'3@%XHy.AMs>R)g)7艆)TC(;FjT4&bB J{!jDD /P$b< \x՛^@d<&tTVXaM I$pϰ;)gҐ"#XeVHi'<ZŠHEUDZD7DF"U,Qd$G9 b즴M^huSebq9bȗ޻qZԬHCSn!_i:tzĖYK+.ď#/bkeUE[[B)Y{U!}+(R/l0Zt%ykH;~n4)"Ǟ]pKN'Yr"OjYj#KkىH-aEXQ3mУ4D+k#>ZLy["`v>c`PCٿ#NtzRvb=ytQڝ/Bj.ngdmW_ވaڲ=a4Zbqcgܛ7U=rTVK^ڠ/zk0Fj 1_xM[<\t`Y-Pvaڲy`ɐZ#_(mkg8,?FǙiBO=>la'-Kg|Y~Tm 3_xM[ze.u #nu5_<)7)!㛉o~d?:P*&vD>CdhOo#-`P`Qˆ]:"EBڜ-"!LJIl۠9b[Ч!Py⩕=oxȒO>N4Z{,@>" o[6Fֺ~cۗL$BB^Rci>;d H3$y>ϛzCdю X`"OyJퟷ|QJGLBy"&SF^?عN>̶{ K$(TQ`7lEmsy$v_nK XuܔfH9]("I٫`\ !a%?qH$?  endstream endobj 235 0 obj 13950 endobj 236 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 237 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 238 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 239 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 240 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 241 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 242 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 243 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 244 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 245 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 246 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 247 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 248 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 249 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 250 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1194 0 R /Contents 251 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS3 1231 0 R /CS4 1230 0 R /CS5 423 0 R /CS0 1231 0 R /CS1 1230 0 R /CS2 423 0 R /Cs6 1230 0 R /Cs9 423 0 R >> /ExtGState << /GS14 1251 0 R /GS15 253 0 R /GS16 254 0 R /GS17 255 0 R /GS18 256 0 R /GS19 257 0 R /GS20 258 0 R /GS21 1252 0 R /GS22 259 0 R /GS23 260 0 R /GS24 261 0 R /GS25 262 0 R /GS26 263 0 R /GS27 264 0 R >> /Font << /TT5 1246 0 R /TT6 403 0 R /TT7 459 0 R /T1_1 461 0 R /TT8 400 0 R /TT9 422 0 R >> /XObject << /Im2 265 0 R /Im3 421 0 R >> /ProcSet [ /PDF /Text /ImageB /ImageC /ImageI ] >> /Type /Page >> endobj 251 0 obj << /Filter /FlateDecode /Length 252 0 R >> stream HWQs8~թeDvzƽ}h:;x|cK@Qrv{3;X"E BZ?4h^vsU_ѩ qnβ8I.W}[cXo6jsX%qRmj2.sDeM1JKmWׅN8 *V&.ߟKl+qv.?`+ow.vI!fNQمiLvM;̹|;ʹͥqɻwUT^5*u6n_DXf^LlnEv g Xf}Z~թ}{ntzr&Z٥jD Ϟ_b>(I6-b{A?U%d}׊I۪u$#A_Mm>]w N}X,.f(Lmu7*Ð8*P,ih] (16i'ecOc ɚ$8KK5q͎Li"`0Gh(a5#j\9KeFi /t>Z (Tvk-E$zij ]pt0D&+Ø$@uЅfs$;ddjR TPldgL`Ed!剥<ޠWlVCSgC[Ho!ZM/ە/JR ]3r 1#[chB:-ݟ4e)iش8|҄Dr`;oۉ^^ {[L_rPp93` ǓjjV0&]Xs 2^ztFyj\A.X⑷sӛh"=vO=Ke{t 3=v<5zv|yE~NjNjzeWKrY|`7Ѫ 1E)G2PGI[cst<ǡPβdp ^QRomnɮȚDn`A?{]{V6qGI+Olbr{F͟$)Σ(qQR˃jEjѷn}[߆4\@gJ/$9H 9fcs$朣&p5! ό+/N,v'$D䉨Dvm@|O.,r?y6ZƬY)1C=CF#UOr/(1 K`s[Q\kT+]̚h ]E -%:r>fa p,(zk!Db N 8tϬ̌`Ǥ Q^1_A )iD}ODG,tSIyȳϸ(VDS0L.ׇ *.T$ݐ\|Ot䘎QNt'T." Iɶ&ɚ6b8Suͼ˩WUF=媕R!Wũې/ro즾@  _)H?T)#ZVsJ+:DGΚ S݌VFjkZ?W+3A jwl0`uFӚ?s5PI4KV/C{jJ@L"F0y]h+``IqI7j#s\;)͜F raq^aޥ^D]u3 5B2Z_ 1]IG Rq;|-b({Yw^Bu6b~,Mb&E@;r J|&so<"KCudXDĎN&CŲP'|:\lm7Ȭ)i?Zęo-&7(1?2T:|D]B p HFUh.~yd{#eʧdV%iN &ń#x7J(!K[c+->]wߚ^uwwU;+r tm>]?K.IGC}3=BNվmDq?ù3j=\Á{XC#,.,fvj F1ro?SB”6Ίqew*,+Jj3R̫/oRUX[4xJqz&pJ 5hKL~\|RSLƣiBlB-%n5t|Hʦ;&-fcUqD}@jeAlx|3| (Jȑ~KVW51|8]{/'4?0_!^wQ9vBB~c EM~=$O~*BxЮT<\oݓT k9we+_^"<85͆f\vY uߑ^o_:i?!GlGEtڿvo+\^֨TʟqZJrA8ul7zpFwwmo~п#_U ʓ+ ݕ7^H/"G/%櫓\?j%]GNK\>*$~>zKoۉO| PܴMp|/W|!ZCmȻ;YdOܑ?#޲ټjmCvUʼOGrTP|r&[CoKsmEpv/xXJ ow/q_`5|kq\{[E(̇e{Q/uwg ,1x<??N)} QF^ˎ>m?}䳿'=*A|RO* S {]f"Y?}t<^y>w*УOra'nzq)OnkCTT7/tzjW;A^Q]¨5*X*Q9A_G)',9_IH sDf^), 3;S/P&U onKzd2Ugb>5LllZnDf,9Łz6 ^f4Q O}dJ({Yi3$=Ɍbg3 ;wVڎ"&2hY։>v;ٺ˻oNx!.FO\{iId'0pPy%!!OH.#lbf*ECB@:SH?2'wC^Ty2*>]F!7<3T}J3<َCAeumzQV׎YGNo,ߣNs^LRPzr;0|B-S-W.yħ F9=_ͺ,q(iFۓY wRtnH)* dlgpLK=Yk0|m4 . |s` X|"(Tz͜kxe%Yׁlb M7a1:| q,S"9=M9&Ԝa䕚#3{;MT1>o._W*m&4HP)WmV? {3:3ZR5%]k|{MvzZp`v]MԮ]E:,00q~o$j^3R_o51+6D"΋< $N'hB"P# &=( Qچ:Uђ ؓEYIӮ.صk$\KFc] j:g4l x})d{ #0L@*{GGu=` RrQ}0%'^erTӪQߌ$OT`>Mt,D 3r֔Њf0%H7ʜrGy %//#/H~~Y9+ʕbm, V"Q KC<-e}tNi[6bE#QQC؇țZOTJAqh^ TQrc*TwQ#?l֚ؑN)mԮcD417ԕbUoũsTOꚋ<}c6R1+Uw̠\5 *KDΝ .OKq8E5u##3LE<3VxJboƎ[нzвIJ )mZW,U܈dIMN$EQ@'js j#5>%IU+#:F!蜔Cma3Z Y Ȩhhn?5$4!'p3Me}\)wEM3ˇ>j56ֲZ˲BZ鼺e-fe A+\6lk?[W`ecؼ2$L(&n^"mV_9݆YYA)ۤ8Ns?|m7@ƅ?IE@5:mgu8W՝&j禾,xٙ XapR=n䷉Ȫ&xY4Җ]"[}9#;; mw/Md\M&)icP~: jv${+y= 1b}v5n~!Osl[4M?_Vu*lEwf۠@@ŋۑNjKNbׂ_nl<:@"m{~y vcl¤Rvhqg}{]bg( ON1}c*9c_[5w/UF3C@w)rAہIPtJ@)EI1NZ}P ĻD)Dc[OqǪHυYګfpvv1[;ז P]uVSb4Oz!ӒШdn%%q2ԊbFg? u3۟v5=s)&F9{nLj znqӗ睠QZ`bd@3`N.# 0uw!K4l#{OmyV H7S9e#sQYss)βNuQ`hK+c#2l* X+eiE%s8l*v^3#aBل`6󭰐'0MP.؍ѶkA/uV@޽C =VL}(鳻AkDD[뗚^ڧjWg:] u)|6h=тRT-uzX79sRR1;MJ!0&٤CflIBp8~pX2Ele7^nO';iAuXzSҹuQ)əKǾVwWM6gAsI=ŕ) %Xm!.޼CKxM.>I0k&ŢOglxX~EtUFP|paԹ֊瀸u8F\ЊhSWlQO+vMPz1&*>>5 |=ϖp{O1h2(/4(Dvhsqݴ}MύޝXE1/(]8Y8WbC_H|_d+o\VsgR"E[ g4"Ќi(ڂ12MBqɤ+eK!:|c07<Ԯ4W5^[lH]l"VUȎTbYr/upW:PfRH8LDA>vws2!S GS9W璺{l D+[K ӗtU햭 U:6vET@Xn . l i}=I?ƛ6iM)A!{e@*\+S={]ڂȠ>®uQߙ^U-iz` ;,' xtă`x͇`GoQ矼ȗΥdi-)BnX|`n}jL*0~Emڢ#å&=(6t种 "ךRv%IԪb[g8[&q#ozs{o*(X}~hԻSKp JCtHтM0 >f*mZ0.%h*4v7 hL8Jl٫]F2m"5C:C! ]íUJ j44pZ%E]mBaaā3 v ]nz97fGw=TH1A1EU΃Ʒ^[#GGnCѼEgY$y>Ky?O%q1M %k 3Rސ?p 4S{h9GÈ*t7&|hlzfL~-ޱ[n"ducxIC;Z=Hh.u30iO :'y??O9hˬӅ b䠫`[Q1Cj-DufEܺ~*t[jPٯ$n)|I{TI R^zFC"dptG+'"Hڮo)mȞv}kbX+Gӳiu1SNaf8Ǵcj5)X&!| wPo1S mM2jqG<ǩ۵~sׇY>j=<{'=I&5 'X>6co,^,0WJ:<]xUr}1F/PTQIѲ}#Eo˹,d'TK} ǚIS1ĠvUͨ?g4hhA,hv晾˖]P\iT̥müɡ:Xk*leoUk)mtD0g%Ofn#3ug{:wEOၢ[ݸ`]kʬW=W䌄]ZC3^J^=E$TVjz*~ĹiȳM]/&=۬<8iT=UzW >?%|z3"cYIǃ5ZBT($iG.z-/='~W#-^kdj5ƃQ,F"M/7xh.oV^﫱66'oOn])uܔ~"wϰU#x™YAwK\3\ܜ}i7{aq0w%evV{aaѴ_YkJ}ٵ3OV Ct?vLhpf IV]dW}Ν2>zi/6eSΫOaeP"rݬμṇoE^ԁ@JwVeJ8id0;{7]2FKPF(I%d;匏M$оàX8X"%==9hhɈ3p ⚞E{SǨjܣ5p܂tBGKtږ#&q(FBŢpK)MJ%{*)8#1F>8$GL┞1ay-BY)L̾a*j;QC|H Q`&Opңhvb*!V8f bWy2DYX0&TDXu=%OV#A S&Eh JT_k}HP IWbcHä64rUCKaC7ih('ؽ1^"@U6qoA~Mf&y|)-WcDeyղă'."$p i&i"ݗ[q_ɥmH |h1;00K˚ +,E,)GDɋfj3= }M $"ATNl3OV/qSˑ*\z9 dKrS"Hũ<P!(phLb#چd;wdXD $GUsclaCH{77&UC-jUCb LwЌc~=+J1O%j/8 2kd$&b[, jU8=|IϏ[ϏK c#^bb25.B[@;R$V-C-t8Ug$G%BU P>H?by)Ba!3l+]icg*p A2-3_z"⁔6+R*4E, ~@FƓ(Mϙ>ɆaX!$g̙U](@+U6$(#Wq,q]||&D+#y$R+ŔLvQ-h@2L1}X#ABVa-(Qw2;quNVxQ%Drd,WWlz1$92(ZYwiD-bFC#&84-X0qRԤU+ydg¯O2#Q&*0Ԕ$sR]sВ }ٿiM`=)hZs!E]VTG)(ScI^)1tܻə]a\1q{hX\]"GLFrvȸiv5="ɛQϋ}e7@tavIk$^2lD~`T9?4 Q(ʷ{ۣ+̌pc* IS^ 7IIiv!ͳ[ΑbgYl#+83-`鷓 ,r6Av 4g O=4FB:B^v%7  Si=lN(dK & zͦdY N,JO1UUdqT dLBtӳYeAʘ-=f vHTzV,sNӳB rj"ImG)TS-kt& Bn  G+m TŸke:E8oǿO趟9%(Fkv⛗ NxOُOR 3F戜Ź_m rW Is:/>޼}ۏ~>O5~q)!ֈrׯnw%{ۜkEd*/#e#<淗Dx2]EUəT-m^~9%--Q$)h}aNJ>F| q&|Ô2׃?OIрC(>鿧Χ73m珧;evfPUv5wQʉ0wL$×OnϿRvh57hA6rn/qͽƟN|HMӲ%?:w4oewX gsOܺ' 'ޜtMe@!:t0lq!1d:\͖na u`橽ni7&"8YW[uڼ#,y4z.H]VW|9mWt\eye85 .Ў/aqhfgؾ6o8,+I|k +;Di y9 ]e_Ԟ1GU)Dղ~{TA .}7o=4)_t}(n,~擒^2D5hBO^l}Kyz\tˮc2BALښǡ)ںf›O r2!3?[: a>k5=P.,SّQ#Uyd|{ڠkT2m.1͍9k'UkW٭jX%Ej:3ܷoBvkE|rWg z۹arNOWr0w4Gt x5nLHN&']E(r$q*h7qxj^]։$,ch#Ҍ)ĒN'~ jTO!kQ,GpO[/#v-bKE䤽aս }gbZ (fEUvPb;=lZ$ A]YQe޵2m:mS*Ц^ժQF6uu|P jr%mmVoFx07)6l_˫4ҋSX,ZI1i3ՔG6V6EdЈY2g~,?4  5_>7Ypq)zؽew [Vgo59X[eyxv8 K"4$LJ;baH*mGLƷZڢzA^xv=dZ "5/x"p .V #|Rű;ߺR/Q3 jƫ#=m*}{iNEzU\ѥQp +e$""]Zf7Ԩ YҳWJe'lXEcktWJHKMnHl! F1Qg:Җs੿ ;nNW2N !F#hugf%(Y+G 1ui)WVMQ-]NܗrJFS-Z+<8v?z&IhAnHk8I8Ɋv*;;'J endstream endobj 252 0 obj 13828 endobj 253 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 254 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 255 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 256 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 257 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 258 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 259 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 260 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 261 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 262 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 263 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 264 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 265 0 obj << /Subtype /Image /Length 2868 /Filter /DCTDecode /BitsPerComponent 8 /ColorSpace /DeviceGray /Width 145 /Height 109 /Type /XObject >> stream AdobedC     $$''$$53335;;;;;;;;;; m"  3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw?53l-eϡa݀}jԩƂC@c[k*ϟl9,F#vN۷/;^=Okt}-' o'GL!S?t}HU_7 *qpBwtKӿwTj]UHoF6Gܽ",,wƿAbq *@ }Bp6L1H18iR R N5I>+^En}LudSu\ X@x4>{IɈY?%Dziywx"ò #KKLD&Rc\/E&|vml4LOdwJ3h`.חDy'{-ǰ\AG=:vkfHdzccKk\[8C=K,qk53;i'^G*jk=6AA(QIR%g6_e5FI s|P_[]K!km O&2hX.l;dzݣw:'%g;9g1.Kk$9\F/fS+5mki@)p\WoFa4yGO%U[]VZLqg}Rk~%1k{mfZO:]NFMC$uުfE ; @8V][칮4νudbm[|ӄI Mp>+Τ.~Or\oX][ ̗Fdž3\w?P8Yz]4yl]뫵Xkmю.PȿӒƃ%F'9-c#C{#6ȁܣm :"̧k>Jz0&'vwM9ёW`s5%{+jgGEnRYdK[aGb3k:?ۛSkϣtZO)Ӕc^ 5u }r&!ۍPhMv}y>dhOTe a~sef.qݎGaʣvC\ϤI4[\qs{ڴ4&~kK$%i"]\&ƯEgGEu/.jװ" ЅMcZ\˜羫}/s#0P7d+ p?S6pso\su>kW)]S%;.-tOq 䀬`0peDZ,[Ckyߏcl͎$5Z`G*ٛ3$w4WsF-sc x3*긟UѩeG@ˇWa>y|'{+~F=en-l8=8Ah[ 4j%̂]fnǭw0x'7Rżo(e[sw H+XvV@3ٚ2%+'My8T=c-:?r](hoұ8A@sr;Gܢs|̵{5I%X7[0>y/{]EgkDUa7q?02i}9FIM#z-Zꀬѻx' ,a1ŭi'>B>[;D+uv0cJSJ-w*vU:9x]6Hpcxic9@S? I H 3ՕfXDI{@ۘ*]I_OqSe|Wze6}[;D< .ed3s 0qx}|Ag\P!DIMnЭϢ?.YԡU@;ɓDhu]ED ͫ?涷:<H3+-v{jieJ]>_sHcFp&ۆ'BM1k7(sw*}R΢z}ަ5m7yu.}.t+J~W*UۇIݓinDp4dg:Tp5{J[nlZ(]׿пݻHwCVOH-~{iD׿пݻHc4~wۇ*W/#??M endstream endobj 266 0 obj << /CropBox [ 51 98 561 694 ] /Annots [ 267 0 R 268 0 R 269 0 R ] /Parent 1194 0 R /Contents 271 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources 270 0 R /Type /Page >> endobj 267 0 obj << /Rect [ 143.88 507.89999 153.89999 589.8 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816327) /Type /Annot >> endobj 268 0 obj << /Rect [ 154.92 528.89999 164.88 610.74001 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816401) /Type /Annot >> endobj 269 0 obj << /Rect [ 165.89999 417.3 175.92 499.2 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816482) /Type /Annot >> endobj 270 0 obj << /ColorSpace << /Cs6 1230 0 R >> /Font << /TT2 459 0 R /TT4 1246 0 R /TT8 403 0 R /TT10 406 0 R >> /ProcSet [ /PDF /Text ] /ExtGState << /GS1 1251 0 R >> >> endobj 271 0 obj << /Length 3467 /Filter /FlateDecode >> stream HWMsܸϯLyh@hN[XJ`@kwgHh+ \{P%U{~̇IW Xt%ź[e#yQiZіk-]"r+7FHe*eV\oq+oE  -!fB:H,Ć_tVt"L,i{\.2Ft7B8$BȦmvy8_-NGI.H-q sW^Md,UelXEFŇ?^yud-6{/7Q '],2 8&t#YN崘~%T$WmUW6bUt⢩å nCVPwm{ىU#n ~UmSuA G"SǦ3.D"\Hm܉p Uhae)VoMъşufJѳ!r- g֣*wN<477M} sw{^7˺oVxv$tV$3RGQܴ?,^)T[/>Xm+^]cGf;6;L\͏kf%E]x[Z9@Kcxj(C) D/5qxM>Ȋ4;wvUVsيI>$SCE-Pj vA7?fU~ #3`Ry)SSvp8+繥s0;_ftB붢:˭ሖA] vOf"9dODv|Ip,@| iW,cj =q-hakk|s_V3Oc,6C0s4b+~ʘ[5З>ijؤC,)XA|BGPKft}"V<כ/m["\E[~iA̠}mf]{F*ѯO<$/%`>8#gl;Dkhvȍ&:C^(b54ULLΣi5 Jgm$xnuLm]COV'bsO޷Ƭ F!ԡlA,f_܅Rx頱_ʶ|lP3dלo$%J iB0%^n;5NEY?C:-mjpV(l6y;QvY,۹xIj3sW:u}Cz F8b:$<OΫ) e)/:ݶozL*]mK9n12 wUʓ7͈=O{ЇzdV a8 ڊxlJo_CYTv?7=4iiKja2vPx B'))V^SD`hʜ4B)4FSNs%Pz".9 ;1DB\:d6*'ޖNH;h2/V $)uxx8U"lJ;C*/.˞!.!?*`0ef)`f[Rx8R{,F+4׮꫇BNoޅRac2y}3Sbw $  9ߌ9ӴFi!F+dJHL I!*hTT.4qϮG>,o_xTUMCao$_? RCjܕN 6~d2y6,d\SLg4#j+ɤfLao-YOFYgABMlʲQ(~}S54P їu QE{Gȃ1OC4 ICŀji+"^(A7fFUW9$CWjw d ʣ=+)FГv=f᳘O`v1T6$82G!uhaguF-P6|a˝h}drGyeDZv":G֞arV5aLGzL /6U |'9lV3g$:qv4Y(:(@{ !+PK@=p'zer |;Ή n`\QԱ}nF)Ԛir ȩ?Lgȳ<'0> </d; ӎL<9zTISh=d(@_M eҸ&7乼-/C =#ؓ3x&YUf<(YNH'Ֆqe(i{k^H ԟ7366!8af̌{kZ[A !%;"#B/D00qgiѯnZ_m]d؈\z~%qjl[1*Ӝw޵L~9%<1擈: k #j*57ʁYArZ(Pb}6 O5L&&El{SQ̩_$~SO- hOG2TT95F見U xjP#CE[5m Q7x2ڬ; +/e&)qݏM],]i٩jE ng&^wAbΩ e EpUFoߦ>Ȅxmu'x:JGf]^V FTϔ%4==9AmDJxMni]0R8}9>(}~NOd .w.ߐr6; 9Owft)jS-[""z-'iX] XK9d?u;$SY ;!![x4D,NȺ /ΘFqHls2~Yyo6hoƨߑb 0΂;TВYVj 0` endstream endobj 272 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1194 0 R /Contents 273 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS0 1231 0 R /CS1 1230 0 R /CS2 423 0 R /CS3 428 0 R /CS4 427 0 R /Cs6 1230 0 R /Cs9 423 0 R /Cs10 428 0 R /Cs11 427 0 R >> /ExtGState << /GS0 1251 0 R /GS1 275 0 R /GS2 276 0 R /GS3 1252 0 R /GS4 277 0 R /GS5 278 0 R >> /Font << /TT0 1246 0 R /T1_0 461 0 R /TT1 459 0 R /TT2 400 0 R >> /XObject << /Im0 421 0 R /Im1 279 0 R /Im2 280 0 R >> /ProcSet [ /PDF /Text /ImageC /ImageI ] >> /Type /Page >> endobj 273 0 obj << /Filter /FlateDecode /Length 274 0 R >> stream HW[~У`Ѻ'ɒoP3kbn{\dR}ҹ\Յ[(}u=4vjwi/9YXdA/fqf|)źEJE!JYzB8YX*|^\0*dŚ K=kmto~# Ī3+Jl\>-d@}`vn;JAa;d/Hi|46|45SV]m.&-J<^F)Uz)ZZ}NlxjE}5uCՉO5fL{ە_Vlw} [ ۦf6䚙0FHcF{`Rݮ<ɐiӅ^gG7UF#,:HQ½#З(,(.'WVU)8L6{E`V8'D_<-NF"<4^@RZ4 a9PAԋ]ޢ, JY8RRj;aHd+h 7tDGh}a A㎒>2K*1 X"g &;d xq RA$m)tbai'D#ȮthgNyd@P{)\V2$t{(ܒ f`e)3l*HK 6!Sd+-K;K1u~at~\7Ԡ-J 0847Wo޾۬nyfbY{GnzPR#vUvZ1tuĶ/{VL!k<g\+$W("xk7z+G6Ko[p$AȖF4ݤ[Jwl=1B=mƞ.VԒE?qTUr+ި@wΰ8w0"aSY[\4P.heh_WkkpCR%&`0ĕ G,˶b$3ɍw$&<j ]r7Gd. mCՐ1]1x3e41)oDMgNW"oDO_8MF͟zry >ct%pj陁SJG g8u=~xpJ0v sy^\@]Uқa+҉wf>S۰*cqȹ[0ЃŬ\FҀKU9x47d\4[H?өKe7)*?3bpNGpOl7| x>alZ XO3^aϰC1P(.nw>̤9ݤDlrOר )i}3L-Ɣ[~=7 UQ@q}7lDVsszI>SQQ|CR Ч6ςoAp; _ݎV5 􏭉Ձa8)bPXߡJ/r4yiq/Q'O&U+{Rq0p67_I 5FN WLfe2uAn$]{pLuj`(ӉsI5y4=/I*+քK9#+'?1- dw=L:G?C;stN\9c ; xbbٹpzgM<#^Z.e\u~Q,ƒH4 aÚȆg)dlvx}!,O]لbУURyeU cFUH VL,'z=m]+ $ayIJ.fU(ϬƏ] pk_YIoHr,Ϙ l K )V]W") !Jd(HJj f2V3\ĈO[Ն^;EByV#9|csyk^_|xx>sTOƍ!`vKu7o1ůyaN2 7axgp巿.vWޭGs4 ؾn+Ɂ.R\쮑?GfC]fVy0_.Mj3fƸca5Щw֭]`5O1?tzbR,6*Q]\ Xw67] Jk2^$h[ݮWPW *+sȇ~^>p0vؽ]Bj|}O.K-ry |$ JUJd ӛ5*,_iփ|%]nykHs4ʒz V{['=\t: 3CvVgA?S -_ p {MR+svÇ=KPB_J!+݉_c;@6y{J"1E"'vcd><#dzVٍhHc!TRT DN;pv>Few >&ƅGjA;8MAMcʽ6ǔ x?E>ifEyڬgD6dl%Q&ٴᖹՁ=k [kC?:nV #]m ?ݖ+EZ5T(&RhohčHf,EY~e>LQIM$xV(ϊF=zޱl-> |x4 zv*wU5[ bioJߴ ..`>zg%^t.X}Q v[>ė'7ZyzQg'lf9ʆ]V\dÖcJfHqx0mxY:72RxA*峧xa*/rn7wa/X7Ygq_} q]dgHځ`iBƥ+^n;&v%y I8 z\a&[{il۴-x&7%>-,_28m pW:CMtu C䏅Rv&ax35ZSٯdpCAQ?haͯ8vɔ]<4mgup: v,j՞HK2j]6xwo6/Ƌ{c;/[R f6ԿKul@1w-ܵk'ĹW~^lPem, ߇rz\{ϻ~`SWlg^nD9c b䐚 䈫\mP 0f`7tL7zo|:gJŪbcd'S&z8Co"w 4oY۔9jia:QW^m0 endstream endobj 274 0 obj 6079 endobj 275 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 276 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 277 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 278 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 279 0 obj << /Subtype /Image /Length 30934 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 428 0 R /Width 334 /Height 250 /Type /XObject >> stream H[TNjKb: 38 `X4 0 0Z`HFPhT-j@ .$ii4K?rιӧ9{g}{~ѱcǎb.WUGk/j}uǍ:;I@ONxzז.6Y-ﺻa /ɦ=_ԃ9`e9a`/ PJIo|SCV:ravx}>{@0 ѓ}KߋWbqT,H$ɡ䰡TjtV^f&@L6fs|P(JrR5Ro'wyldQblS>)/\~ a R8hDb ,/5"~ C#~tb! 1@X#,LNɽVeD,n' {iE\@ "QbR$Q x&`!I#Ž4,݀$qS(%O\>_,J 5D{v^i)x0%`9L%M4xzL@03ZϜPdrKp؅kW7>h} %ysH1 8Nd\AqlOOh8HF" j3'Jyy0~Yb_.?;97 ӌ2 ENgi= ҕaI0U*Jif̵-i8^嫕bT U-z $ Ɠ̓'G1Ldz죶dtck2΃+T#B. ==}'߹{}bͩPtw|1A3, ];F۟LƓ-E Wg=*cJKQr t *3eęgp4Yxv3('{V_+ w Zf({sry;O=?`G0yϞh~捷Bs_oع=5M&ZhRYzœ I)jXD́W\[O? 6(uB.*|zg7Z{ [?_Y7O}ɹH$u5N39l{IA.[u[lV8%LAB!|ZG!08h: ^-1|7.J)byA_(yL!aBQ23BW\|)44b~;aĹULq]uUKr "b]Ss%̚KXh?rL"*\4}c1qZ{{gܝJekbBp:%\v KLK = G4"3edc"&qc-\A]HɓDÜ*i7BkZ&dɭwT2 9Xݐ<.WKc({-Kd`ٱ iB&RED5 sԈ :des,7eVD5UWbk@Lb […^w+xˢ`aCvÿ+!s si4"}^{>/ n_^>1LT 6Y5u2M&Rȝ.|˳:=:Cۖ=^ۣԩ $Fp9LގFfu8zH~q'J$wtY|GeI4mL8wg:_'ϧR-r66 P¸926m+;hK)"E-#w5}|V#3TYJ_vVFR$` [ <{xfAi6s*ɲ0]&;p:r|.c]ґB#crǐK7gX&?#(!a31*c%?*H|K}җڇ̓N){A,'BTi4i*]h]K1̸< Eڀ ˣӛ.md4zrj\F+䱱3>"Z/%n,tDcȞa7(D9Xbq2ӊP\7"1@[[QEԪz8 gG2x Ҽumن73wڛ)8It4JG$шi>l{{G˃а\*=ޙPe#P Rѳޙ$6aT=ˠNKq$nsm =dم*e<w:;KJ}([3 BʃKtx*N'iZCzdw;8y<Ď.uIm>Z4ې-seTӳs,}*z$av3ËL|˼4fG*SCt"j* Y 7p=?<,dz5"2R7%4xv[mF^&jܖE/vv\1lR_mM.[ѡԳ 74(4ajBރ&@ޅfry.F\jd0_Ukt#ӗ.4YKv.Z3uMM\ӺOkQ嫽Cbt LṼtڙJ@fe'b*6 dgm倳R-qDsjlE>%oFaGXՄF 刟*!Krq-= ɂ(^ԺѸE=}S2TJ R.$2)Nc.0]/ Y*Uyn͆Q:JN= Lr-91/M]B6.IXzP1, }[d`cYjkc\I /YD{:+<7$)/'5hN/' u!&Yd(:m\7XmuKk$Hj3YҴz\ ^6l3Ǝ[;) /s\p&U^ [%@դb$FnEƩI gwt73_GQG%JNv +Tp>Gd:=]*aTx Ņyz"?/j;kw-N.O|0qn*4=-k܊HqnC D* \ԷA[C >>0ocgz9M 3_('!Z !bcG+ h6nm@4%BLv۾M|?JD%: l5p̪[<=RYmZy;kK-s^jZ~VvX0vtvE'rmZ΃)SGkX!C!R{Jev? P&0H|_FN_7$B/xXr=(LIԪ &jz4s~+&vA%ŋFz4(!eX5xZ JaT0xckkwwwvWwIG (_SX,\ cy_Iam;Tqm'*d z@%9W^u`xTÿkPsssoخίQBiJ'G?mmENgx$B+<'u i&tnKOs+{y{(s%xT@&_GI;#xL(:S9D~KƖ":OW3ltbzu<<<}$Qf9Ձ&eb5̛?CCˣxЩ-,̾ ahHX Xv,jo1F`eٿtwmERf2^j#1SE y~5DnHV4t3zBF_:Pd~rnбVzj%eL1~`&`lSPgxZ5'$@SKHHHve%mi".z-=VgEHӓztf; p'v!XTŲE33Z]@%I3 us{m^ %Yt%Rem"|W^䪉0qd1͑NV?jJkBQuNKeve7YP BጡNiC5?{|+Qh#Ȏ= (.Ux:<44,,&e*GԦ*B)@ Wf/)=e=?)C*k3Xq[6?c|ǼJJ^x 1Hj"tF.g! Mh3)O,`PJ[[*0WAjC;cdJIz?~Oٰ|˗433sNwϢ(6f6K<ɭydo?x. Lԛ?>=V96g4yZhνsnm7pI3%{f@c-KЉI0#ɽ qEմY>DX<#OvW50;ۇ&[~T|0x҅S>{Q W+Elb}%v\\ҳ_}eeyyyckew~RVGh..kÝtkw߻}S37#|[#D@R~B2I=ؐSgZOdtIK+3HӀ4kCTd>O\hu 8zȘ6t% T92ӱ{c7&q <10 NEc΀Ψ}{;[^۲i ןѩMd_!p8ʁDg⟧ww쫕/睺uqCf2J .,`RzL/"W-Fu3i`!j޿0611N16WfmOi|d 5cu~⧗ffnLBԼO]SS3F㻿?sѣ'/]MO^zLefI}Ջs{'s<;K#SYڤ}>?l@ "{&l"-H C*aGIRG yz%$NwtBvrVx{#GG&ڎM~l@0 X-DW57Q^+bטIJ_Kẃiye`aT g|x}n0tiZ`<ueA' zOQQ `@7(u"\|p˷bVW^˚%ZE˓IR'fI Jk^#4a/UT 7ӽT$E 41˽=Jݏ14b1Gm::Xg6gf|v`$_ky1MM-wr`OT7LZz~ٰo[*JVbQS:?&%(lz4cw&et݉]#]t9;v\r9n; :ltrh-˫p I0MT (tF^// |CDxьKSTsjx+׹_=vky~ϗVfu;37w=ӧύ]]~%cRGHH2,f:MDS33N%$(jHi4P Og9݆{! 'B{b_8jƛg[|d?yqwƘ;/1~vܻRCLRSgSlMD4O"`* 8A~äCmf%5l耶ҋ M"RLӺM›ۻvg/Y7{ƍɍ;XKµWkw=e?"Eǜ).8QX,d!/5Qm˥J&j(7E=!?7,ÑW斶v` ""{&4c7"W/^;L.]2}^y共nls_˜o8塜aSO1SP+Vk1 6h--f Ld "fVJ~)Osb[ a1O@Ӂ'59@EZٹЋ Ni2Y4E&B! o.n}>^yp6!!e as674466b-mh&r.2JƷڬľނiZH;4muߏɛ,Bd90#tyM9% > P;h"ZӉ4AcV YH ,!}|Aټ_.Ld>N7MM30TcUlĐLb*%" ~FHjB41,L&*͖VD’fp$Eڗ«O&ϜjTbdAJQVp$QY ~8GA k22u~M\Ц詈+%ffQ&TXijj:\x4{7Vڟ޷qcw\;Lf7~˦Lrss%&nK:m +jTSV,mZBtzjP?|!N|!/C>Xh"%{C`ѓ/9v@  W(_.>CDb#jrVƴ RmeG{ѣpzxr)ADO!(JS42 uZ(s8߸G%7P \a8Z4X>yTf!f/Uݦa1Ri 85JBҠv1X7JUhyG,/rɫD2$k'Jv@%Ta*ɮx^IN.m,HϘT?GU?*p9BUW hDrM6[IWW97wo@ꕦ%D~O#P`S(T%沅B!D׈lmm; ?'?ilENxjngbr^f`+CJDĚٮKwi־ҬQKNB5 woA7T *_LINIGN9 ɔ˙@ 9-=ճPG#6v/< ]4L_6B*PH UW%sKL&D)K?7r`f #788oE\ѿh'Gn%b[w)I2uL•%Jh6%)Qc.grl ,[kӼ0Kgs_#S1x4`ɻtSaX-yƱѓNY՚*8Q\4[fyG(Juj b`|<.Syd Un3}*c4 q^vSِ縼ނjDMI34͖hj5]E4qCtѐQhQ]^*"i<̓϶փ 7чc(O/H̒LΤ;fVF2UÅj1 yy髞KBNטG, aNS ی„'==$/w$jigӸ:҂%| T% Mgo{}mjbj( (r@:ĞwᑑQxz@xNGg4{ J&!< `ϬnLK/Pv!lTǵpy/\#6ŒC(\(:!u4`Yۈ=7 _pi>-ht53U`"M_ݡęڼs5X7?~pX,!+t8Ϗ Љp8Pc Tp|19l|5G2ػXiq 2Mph'2ۦĽzް'{xQ䏧 hebu8\G RRx(\Cʋ1l4QyYdrZa-I^C6 *L"Ϯ-.\\\\^x-Ҧx8y>IP[@#Q;T".Ef<' ̢wts#R ( YHie *å2sF]7΋cHrJV~ܸsf` f s=81HYHƁ CzZx600xYZ|i]̍mo$^c2C`bHdumE©n@3FCj:դ. Qt9nI~Lϓ0E\GOL^g@GW:ӧxV6yD(gWhx4JW5gz!IZ>l+},h/VQ;THdz!t쑀c _ցQ U)r"?)zS~ɱb(ld"?geaNN&:*ImFU]!Uq2O&\IFԀ- l^lW} ׵Nkٍ&Gv;Mv.Zg~SFAxCӮCB&T|s"M-fYI>e9Xl$OfL;/RB#@^)*#{ʉNEqզl 6U 'f#K(lDHSb=L&Mp"}7]4E7NR;rV 1b~5/djۖj`$V6]QNv\tt*KIUëFj,Ix TQƠi[[s/}G{훛Yt:O2hhScm~ZHɤ$f-kM dPtUNMSt8W5 jk>> u5](-wo?~w~Wն63w"yM,vNLe2XD(yik%pZ48m6= SSSccT5BK3kɞNY[9?nэʿ{;rƏ3Ϙ4 w*[7cn6&wN8XRQp"HWMNHHAu6%;MM?7$w`dzLH\ƼDK$BdaҁINY&'f?8 ny(I [ٿ5h3e+mqTr+}ɠ' ԉ2e"x&YJ%d)\;I#:r N B#24njE!+K?L-|1&#s-RRƲX]-ˣҤp@ H~Cj H MA4=R=0c>0W?bO{^NL|DXfsKMxhq %xt:D0Bc!"U5iK֠D]ĨAWzzv/dBęB"4˜_\\LQ7 aJs;:&'є-s:ԀsHL'@~/yl.\,K'KV!L@I$u: S$i#IhN>{>7:6:w 2 ~*TW" ipdgp!Ҧnv(@+ !qwhvQk[g Oe!J~֯Q6g-m+6':ɶ+rt22+HtG4QD4_[2SJE7&]iv:gLN:4]tufPg0$W"v!MA˅xRspi*VSZ 4 $-λ8pԔ¤eH8YbäAg=C w8kd<{'.&u:Xc^V]PǦ&E̝ Vf8 ]ٶqxKe{9zVw0u}µnEcfN_ h€t]4]Ê\B!97Mm.ͽ{T'B_UuG hM9.+hq-ݢu%nSiyr/ g&AYxh~0ʅ;ox 2 fȅ,0 N]sdaDEPq yœ ?}wz)g.rT`>BPR5f#t!49\E4=M!0.e4.06Bβm"Լ;T؅€@YSc$MhRVrW.{pFJgw/:K Ц6xljҽj{Ch`߅hnˁInIN=_[…$y TIW@* i 0|һ5noW,bĨORWԍ=+ ұUَGtryX(ՀD L@ܷvbT:Τs9hq ^R&ny7G,Fx'*m11ʹ a…5faFxlBB{âJZR{C`8?~?_5=7;D6Il3l.G\[aӅdHܕNNBC17#7/u9_.t|ZJ\E<ɦ;U`٢ӅnVs" uWA@DoI54=kRMi̳|EAE |,O,,dȅ D.dNLqVkM?ρdקAsN|a-4#Jl.dNpnr\H5 N7StQ/zqqǨrv0n/㋱8di, 12G*buꔨ(+4K*RZ:KѤM[I|yo&?qsq/ޟoS^pg۪ugľJ&:2,-Zhyjf.! 5*T#qWI.|bWoj3J0#aUUCJf i4š;ehEjmkXN%:{^eh$4FxQlNSu pbv@b\.wEQVr`Zh 4}+ FC+qsH찉;9wuVVqmy [*|B$,-L# (t!}op8*ԉԉ hiGF6!%24=FS ]C/;ed|YM|H U!ѹCUt@eM tތJD"PT(g^3I<µV!KƹurSH`NJ'+KMUp>!RL@#Bn "@ 22O-4-LhI;Τ9.Wufn͇&JU ':'xM/ x'|JMO۠u~J{3fڴiy kԥj\D:= Be}bFrQ9L]Q,A u'dizfEPEb ]=/m A L0i3=9lL2zdͧr9G}6(C@@)S̄ Q cyR1KOZoŏi\c8\iӦԧ&{t|N,en5΄ٸt4YhL}((nNOet" gh3<æ6#q ^ I3,ҤAu;Zq{[{~hZ<4pWꢍBԩ(j3E}Yh2[}>(U2UNn7)p2z#shN LNYHZhm>8Z:zI/Ջf,ӻEMM. v]{7IUS1,4kE_ 71% A Ej &uTHÜꫯK_iVH]x4}+;O~w4۲#}Vy: fv޷ym֟L.JZ]7sRĔj% (jsV5$8}fTMxꅸCEtr)Lsi6W^$nZZToiו9"iv)y+M4bݞq3t,nC8Z)"4׳,kBs䗘2)S:Va'x&?cꝜ15F"aOEm'Px]'b &'wJÙz|p($qa74_lBhv,_鮕׏?4|qJ$%]h*MmN2k6@Q: JJ'%qp#_/dJm$4E ÒnmrvZ}5Qi4;?˹88:-&<}q5%0 G.rP,:Y@D)|u(vJy{{s󠼱3iSEmNNxMMK`w Fz?7[dllK.{_,bd9)-o@ʂgQNLE_5P+O}?(B14i֛buVonZ6F4ed( Q%d\a+е Ke {Gr,ZgGtiwm,Icc͸%GzԖ&-yi~Ds1Yk6ir$A/,i . f<\1b\|rd h;c'@PC*i!ڮTbZ/~q $QO]:3 3>7OaQ$ /:4(ȇS:myf2BVwۗofkR \WN_ͺEqQ1ݥKӒRJv̀(ܟgKWN|^|W_~ݻwqw޿loA}{oo~x[6߻WVVܺr[7o\ߺ_y_޼il>Id'OX_ߞ?y.ܸm}m~tꅑ8BdP]Jm>>#sc%d*I9p!#p|(ȩ{xN1:|> Mh  'ΧZ Bo6lجv݆n;-hSSӱfx-Zknb3ow.ŷm6-0UfQ&A5T#z &9*otZ@N !OXy6302 4 Oi^x^D/|,`we8cq1NO?:O(3b@P;# eݡS^Ee!xk,8U0u8t]A5d\5Tz@z{ V^V>rn|godi$HneQh\=?²CZj߄:+;\YwP{YtjfjF)<daEUFa!=r֠j24Av,@X8!V bNm" "TZa#S]V&>X$*sWqm|>Bt :p |Lr^pn*YQE 3p;].쮣()4-6m/h=j1 oNgΎ!"ҵ%,lh:JLL$$ݮc''[%N9gqM .D(3ܗU#$),]AdRG>UvBfI劙Ȳ'St gx>15 'q8_=*LC*[ ݺ"Δ]7i5yoqQ|S2ge2ޙ>4t5Ph"1k;;W](d‰Wgd4LnWaJ.f.&5GWO9ꅤ$#%5Y%M>$y"M|fS%!6(C[7ݦFwwWs 7/7{^/]>؊$q+0 O/\zng+6tZRD&f>*;XG8TU3,?H2RI&ޙh+#J. AN.6J2ѳ+K>I%f\`j´ Fp?$e%hx<^bmnN^Nnn6mL=oEc&7^oorv޽{˲'caah/9syzmlilz:dALt?S=e~^$r ƒ}6&UC.xbd54-GR\ZA52#|k /كrIZS01 d+Y O c4999ٹ#? rrrrձRsu_ \b<}z)@byy½)e`XNpHx?& G1D.c`Yp. N? %G'ahDt ^(GlWoԏ(咮8G qC\ qi~`*P*%I'LړnOͣՀeiQӥ-1ukU[đK# OISp2 siivzzbb\ ,x p _qG@5ۀHL& b:TzoOSq ECF<\x94Ht:z4}GO=:mk[]IxY9G.L}6۳taHi LAyY' 'zӀh 4 A$4xB\ˈdAFȝ$LLOD?] nβ3oh,eU],Q8Cû-{{EnS(Dhj{8OLX-''%Zgw99I| 03g"&փ=Ý~]xV᤾&<M *djuTCl5;p (~.``R8IqCjdX(a`@#z& h'N 'ƉNnr:{:LA9mɔFaPY_`x^U<Ȣ&7;]mơٺ7*G8MUJHߠǩ)) K-c5ik S4(c? Hsj'SZwOTM)QAFraOƄpYQ\&d3v*,Acq aMʎxs$f=‚8IݼQم@o܉D 9OQ:>O6[έs,b1k:{;(m.0^ˬuw IoL.C(͎TBCM1 *q;2iTnoy\STɩdrsRU#R}|aE؎|IF OCJ$BGZ"%md1lRr2-nmSd>(9&-a1H7Fb ojvٚGJ^ZPe/)TLzx*t\_R_Gw(/5 Q O[سڇ[C7Gzzd9zTM<˫Ƚ"j<-ekkvxiYΫ6<ܸQ5izs_\.MEw\:.]'waЌvU7ʭ=_N w`F(uȘt\(C{C[kQWC[3cʦHN R%7tua f2^f2xʬv%paREcIjEH:t)r(ww#JIE(.~880p7K/ԯh 2ijjڳ6 }s˳ N(ّL$2`#lGd-bR@vp>I'Ti5zgmJ!aMJ#CARږԈ6h!MCzS%M_t=Thz*h|b8az]hbv=Mf/h*ܻuh`eAĄyA`.51Ko w*`E4]#TJMCCt(>0Ⱥ3GTPU\UdfLYjT4]z'h^|"W/DG}^AoÁ>9)8pf$@eRO3ERcθ^%dqUxd $ CRSs)6,@߰Dz.Etkgƞ~=׋߾-[]Y!k'-f<ptuK!T%VJ8gH2VJNϞwO_Ͽ|4edCĨ$YVGcYu3Q'y;%,OMJo* .0WW 2Uܜe pizO*]"Ea^ųuz,I0CPp8 B#Hn`d$!(EoD &F㶈$4\2PDg4ɳsQ*4*UT4'ZKt%s1{ԭhN B_!u]|Jv-ϟ+]]JRn{ߋiF(s^?mWe^0WvȴYɐň1lY46GVi jdRͧq={}!i;I?sF Zx6j2#pF0 d;/`Z"du UxV ';k/9K; EsF3JLM=Fi_Dy.g :8k|x.msz816@ &Wi  0LiFa t#ZL<ū.h[,V2dݯ6U3|oS\-xC]ϴdvqme׃ sOSHZVJ47:ܵ@Wd^ϑu'_@?8kf逗9AP=`Tqh<-0~ُf:W(hSd};^ԮNܑ>2u;dnMx>(0*MkJTEB;[Ṇp,,+qB@Za8fh$G`|/z9XvWiU-Ca6d83|]4'wVYX' [6|z"e = Kz389\Wd%[QeDO E/a#N  (S(<B&hTu,{ Gr: 7/uv5LB׹E¬ϻzbNщ}'{ąɐؔBDV<& L v>.eҭ>>bB'007CBKq=,evTv輫.H䮎Pa ָdœUb>i&l6#OqZ*I6o+,b˥ܤ;;)KWfT(E8185A.Jyy|2~R/ju:v9wyUK7@jA=fN(?ɢ|do';dJnKW-xJNn4W`G6^$]bqt(rB0><i:f[kmӆs ~=<_b>@)#t@QI/ &Z)U)Vek{o{gQp #vh4e+ĕzGY,QR>sn흠R998qLSq}y^' I}mm瞕Y4[@:8vu\6&ދd 3׶w}wcu9mW&w&ۺ@\D44A^ 4”^-.4݁/xi:>hR܊ML0=I>?πTߙ].')9m&\%|ԭ鵧']}Ս7;ɍI{-ބJ`S574B.r,dv m1nR+3ui2]6t,R'%ONΓp hCFē7{<;./*;qfKxHk[_U_-v^q6;qp{m0/N/GCÇ4IdTzlBBIWb`Kmq&vpDWI"x$?&5=2֪YkMI|daoNA>nW*']GrhyvA|kZ:>/Or\̆J|{^Mg^sNؑ:`2&vc(GNBL _?)tDASl0[g=pqvg{)g$t8a?ݿxFn!p٥/o.-N3xyqh0\!/ xz(kZTEēZ )TVV$f?2Fɕ_ qsȱ>M+6oA,#\s41yž̨p 7yf|p;z0uzo/'7+=Ż?u&\4Mp*W[>" ` ސdڜ}0N1$a¼N50N/9hvԦ+w)n5 ̌H{ZeTڕ͍xgrߚ{KKhTQqݿ3*74MuI@iB'A1+"cAl s_0pWW>_ȱMtQA҆,pr}7G=F=7`zb_3wቪUWU?5T)~/v֕7騪Qۃew7.,|b%qBl1-MY'!o4gdũsfgι#7۟] yqB]+$98{̈8Jy(ѳ<9LԦ8=PO3^4 eQLw[o_,>?OBKMSDq2ytf _drfnU˵ݦ'ԗԱ#SiBk]8 u[ܗ IFAݾ1Iˉӄtx5MxȃfS)xd{XPDjܝr4r7nxhktԧa+mNQa/n=sj))>q_u(X^u u_ށi(OQi5{ y.<%f7:hƗꀟ?ҕOL9PD9p{F9BROߋ=kX{|.q|LQpӨkr34L)qك$=#JN"" F\Kar5S2&+|NrwE;@=\dqC2\)&Ba  c1k()bw!itEm1r&ĝ&E%Mŧ$kddMM+^ tuNtϴ,KӔ$kgqpLҰ N m0;~~)Ҽ_£gAmᤍ*d%yhY&Ͻ釿 >\)5f /nOC̎aٶ%JEJ +Ќ ~@"GMTF^YMkaP)i &m?If'L"cccC)ՙ?Vmpe/SynjxDg:<BNRȒicJUרl`; ;3mӂ!?'W-!FhL..IS^ցyߔ ;pr#ֹwn^mZ(.A9*OP,:IJ{NPlCIC+KۋqkYbg<[eOќ4X l&[?翾o^>Z~|oe|럱b%E={+^'\q endstream endobj 280 0 obj << /Subtype /Image /Length 18454 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 427 0 R /Width 334 /Height 250 /Type /XObject >> stream HW_g9dm܅RK."pBSO=+rpwéxZlT̞D`r==O{e1JӾ$37l۶} Yv ;w64atP]_bo4Eȣ=2\wBX1vhѻ~M4JT Vcqmn퉷ZdjמwW 8yG'Լ^%Z~֘dY>qqzkO&FH݄{qHNauvUD5e}jOʼnWç*~# pH+3K*;ߏ6$ 6 *-(&,BE-n"dݡ]yuf;"o#T+f[=Ͳ+H:dMSV}g=bWggWwG{{{=="4ztw؝Nd=@>bWיk<fh?n$mU hr&ǰm{}у-:m ~rdh`GzFrO;㧢buMOCVP˟jsp7g10d2<]3xg;3vfǷ;ĉs=u⳱ώtH,NO!qXu)I Qt@*Tc'gfc/\|SN:uJۅWwoSЅcǗo?>&EofxE_ Q*B`J^U *x$I[PL22d뱋?>4r@GCtOjp`ѡtvkW>:qi}rr۠Nn2 */hIV)TObUm'-S1 5[$9s !Ɋb:Ί̦ lNEKC@%HZ9~1 Iٍ!2|ߡHUu0zR!r+Y<6ړVوV9S{EJT=MPtUu ]Y-5](y^b0'Uy#"`43eGugs2J6O.omlSQdлс$~/8byhUG\͖@4f!=єmn;?050*։"tN45Qלh䱾&h:ĩ̧MBI['BSqRܽ޶6L 4kɯjghV6t+ :ma"gd|`uqYة 過)%= I0Npv HP.wH5+1S~잾kpVA:Q$ .X"{ M>㠩PBIԁf Q]?.mV6iZV(B!T`MΩI3MJ$4G !Ppm9ŖX1`!@)9SArplqD͗ rs*$ٹ^ ĵfhBMI 'X T($QVb~,jRT(: 71M!4/SB7Id'N㩣'lBbէVGfv,k Nˏ1woOf]Fҽ͇:RԜ-`!P>]hn&qk΁_>E/ &obdHB(GJ*JʁTlè7W̻P7ɺڏxM3-;F{ #1?f7*P:e%5mMG`Q# uEko[F:ڇ΍$ZG td+w !M4t&˧zEXf旫RWg21?$m+n-QM '2I<9!, Ը x`gqMko9W9:Tra*#S,!dYHŽS;Kˏ ~Tdʸ Qp̱V]7MCB3VzFCȐ]@QoScWͥW/^?bIUE.R`|.c͐>:lI̩cUA&f!Q:tzqG}e{+T߅fW2qTBV߈[o͇mJɿZ<~|\9[)4/,i٦ Ah'ܬF^Efr){ftXh%8J8ZR YњK.Y,&C$JQ*KQ?zP:7 [Ű49NTCf_,e)_(V[<K0lZMʏȩթ˛Y-RcA`2 f]_;*+mY _>O˘`CdYxaBys3IA,yEha4݆f4hd8&MxGuzBI` r1AUqdBQxGβXumD6^{UʄÛ 4rRx> <]zIv RZ!_zbGԩ)hy1YS/䝉 +Z~.)k4'h &)0R~e,!e8C*tr3+nKVy A5 ne462ySOj " 9.'d hzo)IՆrf*gH:p389v|ɨ|٦nuPaB N@UɪxB.McP> >fnv;}I4])szNzo6un e|'1XZPT(_c&Am̬U`~+mmp3@pRUH%~JБx!$gz^&W⃢ܳ,ȁw,}!=FVs5JKRLH;'CFE|L\aηŤ7 Bx {** *$ZOTJdjR39YcGgJrK8Y: O&&Ηl3cjy MPj[Ì{On)]{}USK)*a-楪^WReYQd2ƭ MbJelvU CoAIW!ٝ@*Mͪ9o=8i<J P 0$!b鈛Ǽi|\ g2Bxv#$+"sC^ȋK٪q- &_'pJTP"nRT @ R=}!Y &0(! B(CqDzX̘@yU^h6&/?|jJaw=ݝKm$fty9jPJ/y,~aٟbk%^l D啝'gɾB-*ꅠ$ ب q i#A/01 7k4wf=ɏwϏ͍_^>x姉;/&~H*P-&4=bG}=5xI,q# ss]ݭMnMͼo磳#&4KVy 'H!BH[2Po Y%DtO[~_V:oeّͩ's;&k#]o4o:3;q}uOsM+wot|utY胭֖ɇ{fqo,ܬeBM6j*Fki\ҩ2jHڵEo&vyHԽ6h¥(MHŧ:/]h?`#w/]joLw|uU'qpG.2 pkmUeMFm%Y<~>i:Z!/0?poz3`TH~ J@+=}ѿr<10+wuT=ː=7tPZM7A*tnxvW;Gw~ޟn7lMBuCƏJt 8MpEБ$tH0rpmTG3^?m$IUBgr8⑄$llb1JEɱZiuqC'D>`X.{{?vc{lc-U ,")LFY*$?{ޤ~ Lx"L"ÒnMflvqa|ZtUs{Σn5{O&d^* %LE%$.Q:CibK1mK{zc(텘sՀ DlJ$%@fv##G2;,eMbTHRbMi)ꌤHbR$p]Ȝ!PkR պm#Ӛd*$)b0 df?x򦓠)tdɓ I[ .$HQPM+LuSCZpc̔rj<9ʀ,ςz<8IGtE7IBi7 JGr%gyS5m'ʝעB`!\(Hdδi7{:kt}֢B?5%NFLNKSnz,@Z뻐jrYgr^҉I'ӥW:AWluBWf} eAl7^]d'E, *(VzBҏoٿTWs慚WrBc=cQw,@AI<{/TW"۹)B9Q'#\m̛?:kti}*vSv^<.l Iɯ`Z=*G-}|ca9Tܫ&R!Q驀N{!+za~s;]t+.x5¶%71T'O5 N[Ts^ATOyn^9vrLO,3QreϮB($r(4Iѩf_Jͫ&WBw`ڻ H{6M^V#hbQ^:MHDXhQufҏo\'%8U"xER/ꏝmey^T{ $pBxBQ0lȇ=VE^IUHPvֆZ9l38u4N{]V临n 9nWHiO΍xظJSF8np&^K| !&ja E߇^pG&nG'9gfCG_cIAܴt~}{|de7[aJ8JhB * *2Puڽ4TMUnfGt7_~/4pu8 I6oFbW e8B4'3`%d3EQhʔ($ia2.^hj//>m=?w=:<2*zۃ+ԛW/+7ܬŠBE+J DFY]BpB ؑ ͮcs#wdy&K#2Zk$k< ?pݾ% jjڸCTR>x"t-rfyс5E H0:cػFmwWjGܚ^ך4(ޟ9<:LN}yvf,e-{Rj'Ѭx|ݵg2̚}Yzfvn :4ȉ,TKQzh/R)RC5z&@A(y3U IUI늡KtURPZA-T\j$8sz`]73Ƿ!eoXzIvsB+-~rgУ m&equU=Ԡo -C3go&&^ZI.<_w09m(D"&B (k"" 9mVhI<(ګ?o/l\Kn/t ykᅮ6 LH`*k"r ĉW=w){wVӃ/޸ Z-TheU\F cbP7*l}bl_,ҹ3)<1E ,$8/GYWra낪viDO3MUU64N@B#BR Bީ]^U9Xx="D&(+0G8%MAVdqU,)3z9(-Ǯ¹zp#-Щ:84Xv8#BnF-KEU-WZmP,@@D iiZfڲ,ݲLdcMJzښjC;o|ηN*x=4Tg2:Wu2)$mat.1{5O+ƣA$: |LQYZi0 t ඦ{ A5HT P.7 Yq@SJCO"1j>R&2*uqB#G',(6HSU5S,cVp49i׊m@3zcdAu!>ϟM~rq?^ ht)O Rueɐ?V=r09nHQUf0w7"DBtY()u&$BbFB"26N-N4"ib]UI#TRT}?&HxnڬNq'$aD+ۥ\ouUY|. e$|F7d;!9q$S Li3|4^fz_$N Gq,sd/l 7}MwOM祇}{oeIP4r:̭t 'ŴYstAEN\ rԓt\xk{!h*S/|387F&g8R w6>1BӟBKfH3ҿb8Z4PA̩".K,^җ_.~{~ֲ_Zzx7B{];I2Zxh֯475=>p{MHJEN/YzIz3׹49<7qBr'A%"y7љ=߿84+^? rccwcx׋xۑ[K㎅WTnXZ(9@?cih:gCEX-C%yщtt`]9g 텲޳Vt $v.O[OLn={R)| WYcc"7bD$&R9i29䦆Hdg,B l 4 khi-_zs4Ā~oA8*iKs"a!t]騢t,SBuv5\J]{44 ShJs8ޠe!^8ibemq`e̫+p:/P44 )Ό)ILL\hrXȨRQ3P8 [*RI"nwX:DAԹ,BNlDpz[pߤ;K(!B-MNn~ ԎөsZLYQe:ecJfCRU%o{":G8"Pi3Z *Qw/G3&W I^$EiJc!^>oJVIVzT~8\\4wre!ISL y]-i)Q醽}.]-Ӧᰐ DG5W\ &+qk-LVK0 r[q̖?_%lȕ՞$Ⲑ4uSsky3 `ȎPx"sN eY mKe~+#_z8Y54]/"ɛ&:P2KL}]6K)9Xj&pJoSc/OXփB815uGNͭB>xZa 0BsKԹ]Uc47kPY -$9Z;C@* o2ƒ)&g~C~e+ulnl'eUoiˋ[@3HmGUKRZ43 -o CBT+jvvמsm؉ iܘs}s9s '79A},Euy3@D=Mg}^lcn(W\)3>GtMMi>Bk{Ӓ)1!ζ:$;jK!؎  9x@(ONl:t+sT,B<|0"q: {%u9sWJ'M?O4?>?.e ~q/zwV6w&Bda^`ܝ?^hh:$>󢋁?kZD-++ܥ˛ Z3KMg/wf7SF8E'm2bqryBAD7s'ՁG}GmN}Q7=>?z{+GU>#{wn' + =MN7N:݌,_Vw'D{Hd& )HRl$Ui*za6Y~srg|}hП&:jڵT@Hx};>mgcoNLns}uퟮ*_?N_5{k9̈a09(‰!JL ) #W/hZšW3RЙl~qqt]Y>H.?><ϳKg.Qdtwܵt$m]쓁3]^ykXF~yVuzV&o/cr f 5㓊+4 B*,qP434dq E9B#9`J('Qꛮyt6ܶ Ɖ+ c\tW8 FMPH?p(Xᴽӭ&v[e<C(<&RyozGLl]qYt\yRlWwoG@eAXL@ey'BZ- 7d7M?_\]:qԿAi4Fz_'ŠQ(Pm!JէQƴH(N׋r:C8gy&?4I_[j-so|ܳq |Yh?gX0l8Q|L)!.08G 5Rk*MLi~L0 ,/L,ӡn)I) J&7_"W֍ml8ocӫc_e3%pXG+ (Ǻ{0`ʾŸ,;3:VE ?hRGp*W"^ M®%Ux V^aLa̩4L;G)hœ*X+@^w4J3 %&ʐ P.ڪo=YC8Nhzב7Yh65EZybPmɄK`LZ]DbfׁIovXni!!bc~۶00`@-W"QԈl%aڼZt݀l{+ ! ̀n#$2+"TeOnesIQtIQ؎ˏ99:; ُBT|P8+g/0s ˬwWke02)j:S5|:`$?IB'P"8I}HsSv]7j3t *#* ~ +ab#s9-q3ٛjwdx/ tsZGnZYJ0d'4]x ,:UV~ fIxefJZk DFS׆&?\f^KզkMMBmÚմB/@Qm EW ͋ªx4\ź pZ%% XOajD‹'x/9SMN7ݯpPlSZڌ)}i* s`3[ 3s-< Σm{$*tκfm Qg窚 Dn=&g\2iI&!7?UrMP $ i3XTlk!{ ٯ i8#`'fa>B>Q\j tfⲫ3q-źe:y5g=,}jo6ФIQҒ7٫!b-j"?rXgvޜt"B?*d+j)ӏF,|t+ez.[TpZ"J\4oDҗt' '.^BMS)j㣣oz{lu="ǯ %vd'Z,H4o`-dYYq\T!*ǙoLIĴaBد\_IZY&hNDh&sE=}AR *5CTJN8W;+*~^nRGǢ<=z94f 3hZ(;B7!U,(Y6Tla8@ %DXmtP13)+~ݾ qܴC&[3$>7e,\6OPl}!u] Bwt%7~?h-qS`t&X#rߘݰwqyOW N![HHFFtlPA׉~x Z:y2M =]?u[kf$3L^̈|>#{y1/⪸ڼiPoTK#J&5&4ryy$pVul54A~`4 `nUQ#OHMTfzNmW渴 THÕ# {lH8 (6\faD)*`v^|- >7no/ 񹹸xz:dH(c`(`5`mՑ g[Q/~P^u%]̓Kޯ*hZ)rZJJRyXPWyhFG筅/K@NFC֌f4m>Uh97;)fB oB\ O~)L}#ۄ"ޣw Fr"Wd9ZFa]MpYZhznY&L8'ZrzRIHLJʸGvA@fu ^yiP龌HV*\Sh7Q-D9U!o'Kݻl^VM8lT虣(z8ʈjV|V*EY%1lUH 95I`T797Bb<b' 3qy'jϋŽH-V %0cOR5[N%6r>'vG1?MX: =Tj+y wOQX-Ԥ-dS)+>4Z}?g*jKrC󫻏~dݾX,SY=ZgHK81~N! 9xzc?UDK*PUKR2>Z{zTlKN{p5@3Y.\슝hx39]m}X|3KMV v~n;vcthvBdft:3y_& akJfGG=͑¦ڨ2zgIv3U*No7ep;on'<6xxM%l5 bbTHThT܊ӈ~J2UWN6NwVIQH7c@pw~8hN/k/_;uVcbW"d,'[Q F kh`'6g;͡_ !ڨp1Jy06 m~I%qIŇ3!Ʞs|f4խE{^-t_NccdL!`u֜l~c(*$]OF0"q0vIB1d:WoT灇9 MguWRYU=6bnMШ^/Ĥ/x=`d Bޅ%n,Q݆unXߊMŶf 2*a[=\}7eBΖeŏPKVa 9cd 8]-6&]|$i٩2sSؕ쵓kVtAi;½raL`7! DQ|v)S/\,rBj9QK{ ^fz3Eeo vC~ߣѤ,s/5 rQ(S3co:;?})͐sBv4m=}Ss^!?>"Ԍ͇@FMP{?H.]|ri6tZ>}{s|t' E?~=&Iv{CJT"?#D( >&M~Khٚr\&?Y./_>Vy1~bFSg>s-B0YoGWVoNŁ[\+4QU%PȧNUxgʹplha! ,.r/, |Ԅgvˣ#$tֲRbM;ǑR/9l.}/stc4  [+,B0yA <)xI/s!;,<@KycxQ<_\g#4 % endstream endobj 281 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1195 0 R /Contents 283 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources 282 0 R /Type /Page >> endobj 282 0 obj << /XObject << /Im5 284 0 R /Im6 285 0 R /Im7 286 0 R /Im8 287 0 R /Im9 288 0 R >> /ColorSpace << /Cs6 1230 0 R /Cs12 432 0 R /Cs13 429 0 R /Cs14 430 0 R /Cs15 431 0 R /Cs16 433 0 R >> /Font << /TT2 459 0 R /TT4 1246 0 R /TT6 400 0 R >> /ProcSet [ /PDF /Text /ImageC /ImageI ] /ExtGState << /GS1 1251 0 R /GS2 457 0 R >> >> endobj 283 0 obj << /Length 6140 /Filter /FlateDecode >> stream H|W͒ )x޲$d;Y%؇Բ%jl*'S>쿙YT  Hhq?_y` uB[BUTA]~fQJZVF/bPJZ;pnio~\}YAzRB,LPr $|.6$:T~ۭlЅIFY*kPE)F?3׺^2 ҂d(&Kԅ [,`gx_Pxxr!{kط596{}/|mC.+BvjmE塨tj?(0ܼSn'S?rme6o@owt.c 2|JMu rZXy#3z2$ B,ke~WɆvjr-*iȮu֒n4ԮUזy;Wb3>/' Y5w9b5$Bj[l 2yI`<8 a@64tk.!I) ]!30H24$IGڹMu9y'L>(9 zi#- 7#dl/=51Ow)[*[Ka%FB&JIo iB%}F}p4 ,nOd%KR]Ӵ V]]w$Kg G#l=;|C\ȹNp%y*E@.{%+)k(cǃ3I!6%& S"e/PX[E/R˖[&&=Ҍh_T(kDJp |͊ =ҹiXmds^H_)~9AQGvMZ2SYӰ!VcR֩O}^J,,'&gVSF }Ґgdo&J5&b%Q(5% P[A;9ExF+~`3KiA>՘2m@ 6,p#ǧLWiLTO>/Lc3 |/'V'׉mX0rʴsOL7'7ti$j]. ږCMG5 8='9E}t87m)״A0|mL:T)jdU:8f&%)֎M 76(w}ғ&!xoT2>PJlin_I ^jHtzχcnHu!<*Y{|wO! <=s#6C- 䢬RXmZuely3GɈ{jeԩvN_/Sy%,〮 ƚ,=Ih*#2gztK6Xeyn|b"^2^v"]e[-p[1+! +%Iˣq ]Ƅ|=|>b덂OPMzG⏷_׈KR%8_{oWϙCWz|/ߝݘFGLy񿉉Ø!iYLmm9֣S^ob9XsJ)1maA7透v3[ߓm2{01}0Vo퇘}~1w}I4M>Sö{ʧ nCˁA«OSW^@,fIlnԞ]ӳOҬ}IvH2 p%_;lc}U]yjb|ώxLp{l[[}~ey'A,U&"?2YXʁAF;k 0Aqج8!2z,:wulaf^o\p5Ad|+K\nv6GKo% VQom7Z̔4ֿ5P*unF3t3u/=4gSG_%=E߮8Օr i_˜,%'Y]4f+RXHeb 4^oP.XӍjjV[V5Q/ac ȼo6.@q]QplLX0ʓD!QM#"e3I$[qrZdb9[-Uv9q~vc \0W.E;Β'^M#+ITlv*z_+ͮ⯊ ;fTa|)zCە%S >L 5ȡMt(SIDAŪr-a ;Up̮}: kN/YwF]9"i&֨ J[rd7tk52/tlpJ%}h:i#ҁW7Y~ Ex^+03f!ѿ?.y S][$hm|0u>=ez\Ҽ;Yu +d697ݕ*0>gW kz (Z[flǒ\ܻ4+N>y\[yUroCw(Z 66./zy/亐P0)_ Vy< e{v.'xIہ$l6;>@,gB@qe8•ntG b ٞ=FUx!7 p!_D7߷Wۮe3pݛ-P._+;b:tptA62O͸<-d =C;!释3X=. foZ6TC'&$VJt ?e n*Q%*NX+i=)?t,~X8աa땺r|u[{ ={V'na\|z!ضSwoijk$]'c2y$cT | ɕQ]nY$5鴴Px6uQa{j-JPRJttNe R0ʘz~^B_TUS/׼b}8mA`/?uOR^Ob.5b.;)+.Q>9-[|7TLp!k+APZuW\巇ܚ|R{Hw/ ]uMlLF cp;'_8] UW˝v:p)4r8HqVa3|LГx-[ȸu`*bu՟BvɁײ}㠓[_h\d;SsE6LB=I$ܤzG.'P_q-FmGM`=&Ԇ•ۧx{0%Qd$/Rjo>ZIN_]O&P yN/vSHZd<wa2/`umQlTފ #jq/vC`,i0" ܷ&> stream HWCRHaِIk3$fHe2Up8Zt^I$&asu}uuu44j8tyo3?hÇ?j6i*{JC*ڒMlz~z<`Z(Fڦ4F4 1mc% &ޮrhsC + ifY=`"l:)!$4 Y#+ƘCrH{*W ]laf;au 'U?~];H-RōQWh^inDliMS?/ YL׉֐ 5,t6X<xd{ǢVlT X/FV} TzL'' !N"2&H:`HG"$?w?wOG@o(ގEU7Ps5vg-%'òqb 7\-dNY{hphdh`| gmSɉOpv.HֻU2L!N"v"=Xe` xr3_|y?^xOWƺ}=3g|/>oÈ+HM|F |@؊a-C)( ZɰBm*s7v/_=˭opz.;ڍiLceU¯&t&Ie&2)*hvj1;iCGou3Sߍ_rlhz?oumjT\͘0Y3$7U)ȚR.Bz1~*FAc]>GbXo+bu<#u5@Y5wϦԯI{8iKwCŜdB6([N2YG %,/PUd蓑_ƴD!0X #vq’7KB1B|OkVѫm!8EK Q P H* swÑ͝͞bdp'zCkDޔ@Eo+6 h<@+첧3 yix{~؝'n'5zk俏6|s(?P-K*h~,M#IK%E L8CSZ]~yX[Oւ;A)*ىwz6bxϦIS?s:/+y:R! vr*NAVޮt깢T pyЀ<ޜ/= AfedWղ<3V5m6m!o%0#Q[`3;MT Qr-qX|ߵ}.M'ǯv$=v%j?'iYz=p/} }<q7VM]V=f':2_UQ&&Ur)"l*RB , " #07TYK3I2XhuxlW&pLq"%R!XըCiY-ۇktf3E$C!'/9"dB. ~%M#*KDM!B rA-\)Ȟء:ڛ^R%釁 |DC`񲁟#02q32$YX?U]Sֱn4fKVM4 a!}t&?fV++Yy("R}a1rTbJ'.+)Mdz}BM?|QtBvZRdYRn• !b2de޽wtٸ m4x-j/ӧ+5WǑ xlpY;mm>Tr2L2alEM%)[HMҽs^ɻ 8 _99vW/4MwpC,ZOQDkכɐ l,msЦ05\v再%ڼ.TMh}*Wڼ'|;/=X8;Q3EL'er`.`J+Ɖ Q%i_z̔=<<(K*z*qщ6%n89 k4u3 5% Lvny#;q5=wBh2+6ŨwY#A.$ I,R622$IF()vHuL4 ލ!͵N4y6Z?I[qEhWXRTUbfMΎuhJRVSDYb@/Pr'T6 uD>>34{:صnKOD{YkkSH8[s! )+mNǗʸPʛL=~4@֞yM M%Svj3w7li;8zwozj_Ah*u̎Gև_3o#~~*Qf-(LIF= lB<փЅ2%Mi|j;=TC֜v;]=JLmn\[plDDZn?\L寮O v+4ί/=#Loxh}b+5vEP٣_4 Fc/Gآd3BJBvtˑ7.J J~E bT>Ӆnnzcljs1IJ>ͤsuwIkcm53zE'?j{l|"~HFN^D?Ӕ( `$ul=WK 9OeoH)LypaOPh.XU,k gj;QB,e*khV6/!ETHPTq,Be2 X`6O,sfr`m2@-~!E9>+@aew@ibew/TIӾ$Ts<:_n2P86 ݥcO {_V;JDZ\YW3:!*ki<6{ü^= M3.6.5 ~)ӫq:'8};r*)}ٝֆ܀nhs?PօpeYU*͛%o}4rk\l\gcš5/ItH z[,RSmc'jڐ p7)!L ڬBH2m'}s1@4*aд=Q`;rz-үَ=m3Lt ћU8Vf G|6]q\/- 1{Xql"QlXw%RU]i/]-vP'0;1I; -nP>{gƏؓ18p\_'3 RiM3e/͛{THԅF l Jr'1pl)@J4&o:4MBLuEI֡9R=T|yg%ԿS-3JheeZvzjoaQr!?4G^HҩD*N=Jg dxz3;}2kzD=y !_PE&iZKQnESD匘fR bI$@4}DYe1f;@e;T ޥ6wWH.M~/߼xj}~fMInf%%f?,%* uKR2.JWij zݼ&B"f(YkI5pƒ2-vt^w˥)/"._=3wg|sᙇߞ] ΍r\hnFakqi:Rf^z B2|ozB,#|Q%Κi-ڇ{! %:0+e&HgjT*U'NgEMZ9Ƶ9Ǹd0W|:<ͥqi>Λ!ZKxHh < <e҅AQⱡ.D;&躻zu4vZЬ `pb˒D N i E j %wYί|)p~OUÅh3o ĆM|p,:_D @NzHH 9J0g^"X/~e]B2Ћՙ- Cļ hnjDو ] c>e?ʏe׿%G)г7zB 0zk0™t"+5HFLTRVab:\6X֙NU&g76@NӑsKc@}rnBV^m:$VB^f˺*$*3Yh'%B}r[#<~<hx~v˲!.^!>)JMl|q͖77P.Cně:3-co\$%-=,VƳ%[ v6 L_&]N[ud{e,d,NI\MS4c%24_ק-tfQhWM;Ԝh\Xg{(esl $W"VS=TlRu=]?ZXr#uWMQBy EYnouSӳ6~K+\өko[f dK7Zpzy9˪^$2YU"+)葏a#eM1NY|ztE_}?>w,ѷ&Cc,TH^9vkvwmyB4=Gfj\Y}DMzqѴ3'J $:GLhd*EB%,̛t끣z^u>200֜t[0uյ<#fkj:>E Fɤ;Dp5θD &THGBDȄ"FRDB"C: ] MUW'#ٞhHp+F:o8ռ_nZl y4'<(2Űp y\țdZhW^)DIQ%&IVdY!h#6hik Et2pTUD!D:d%= ,$B5ML60cc;;nW$f٨E@pJ x^Q=J*,#D=-dhRR W u>:X/@@,$0BEQT3 0xy{Tok q˖*&L;XTT' ,5;9'$HH@?yDf?}4ћkZ:&RH1P_/"7Y:Pٻ|.B Em-+xD*UyWG-M[Ԗ_cG}&uSY,GZ,NpQjz'AD8xgAYʼi$jqbWVoG G]lKf[THB`訅@a݉lw\!+4glڰ='_+ڿPsVœ%eI$&#* |WWB=y~QTIʫSB*+jBģl2$eTh-ОŁ`E7{\) YH∅8Ju(G3`L,OsU]fJMj "&3"S7g iu$V^4^|)}f+NoQ |3X,M˧mGlR9e?2k\qoa ,;yƤq|c]"NK6Tj!4=1X2bSiDi9U;"By ީ{TP=$dDZZYUSUzVY>U,.i,қY!0DVN@HA9dNIeJ5CԨSMA3jAoҝħc)ވ/RK+Hj:שR|#L7`}͊1@BʉX881sU [jԲeTTARϥuBWڼLznlrỷ3o>z?m>%ORF /I[Y;E'en @_yh]MwoB#vNvpƾ?Ό(JCYIŎ1E.Gs6?>[z)ьbkģ,fdS ]o *dETkqd[^/o_{ҹ74m펬-L'gǧGO\-?l^Kz0ZIJĺ{ 关 rI E KoI=RNB?_ǾG=e?7/\f^foIFwLM]9snxxsֵGCsӟN?MFG|fĢU- ,;s;d|'WXlpNUރܙzgZo/}$}OM?<`jl|b~p~sh61?91<=  kofM Mgga'ٰԛ AYeM@R*D  Y2Bʎ*u+mͫ//.x~;L:U\e`U9@' Wn9}n)L;N6sӣ%M%& ˦γizPϽ(L4%9ssLL.ꖰn?d u{OQ E9uF뀨3Wh̕bZǥI&8h ENzz8'a٩Tfd$Ǭ4~y)5]o:2`hN$J(a73>CVoXe tM\[ EUߍMQAVgtJ\ C3YrnsӲ\dpl< u~,ytB)+a!p?nC4!1-ҤF-QQ"lu3I,U]Hք޶PJ 1;M'2 (c<*_o2SrSg>?DH^M]ciXvbm1h*˳ҩyɷHAWzcB '!;m61ʚ$-TD8eu6kC:?@:)k#-FJLB^#u*G\ޡ~bBvpS d[p*WL;W3 Kx]F&ϙ[Bi(!=x(wH .n|&!8I#k'IVuH@d AVN? 2 w퐺g6|B3dNl4oTPA~]wq 7HG -r$$a{# _H u3Rx| QCϕFRdJR*i:N%ūBv6UJ-j] _A:թf$-Ŋhu ^z ^#"PP7'pC QAwK͎)Ov qeTtQ`Rbj,./+?paβA$;#GM l苹E8 ]^_# BhFF1_*RSlֽQdt W6|,L{PX">)1&?0B1M2U'pA_* .9hnuL ~6Mov? WXn޵tJX( ZuXj >zg%^(9ExwwRtSZm"oBLlVJ (0)J(PggO[1Jڊ&ͬ:XdFqP vܨ7-z v=>}J^1\$_˭ ɍ6jdna@ڜ7ytGHB,S!85NlNjW{v;U,s2NTF] bӘG2閻!׬EK2Gu]k,*vsus1G^O "tm=r*$S}MBb RHSpBzuEc{y84=Id:5=u~h \h^.T1v1k+bB'$e bDIp&)`^r4O$qBsny/su!ÁBȈ"e#I$@؄sW`4[NޱB2䀤#x݃OŒcZ.ڐӘE:t!s"K,}Բ&3K 62f }&)Rfd!ܔR;`xhFw ڊR( LĄ}%I!r"~c%+ ޅl"ңM!}$G/"F~"yy (/[D&E:ILɽ;&cw|;V웒䷩ɇfO矷>.thkC"43/dKQ[ō͇ln޹Ί;=%Y:~H]akuC 3Mg-vڂ a 8DA)D= ,0X!pS~Ownz \GDtPe,d,7R7KB,Er{]dI:3=΅fX:z4;:##[+WjjEժZVZL VXWs l|дW0$}p4WaV@s@:+_NF c ?V,Af I3g_&THXt"J$KsMUI=򚃭EqgbAGn]PziuLVVwށdQBh~:wݟD܇ov,!zR)e<\llT X/|![ EIϙΫaY|2^mvx\S!ܩ*cgYeO~S1UV0uUڍ=L!ssT4Y}gG1@)x:Dܼj5vnrb9IM$}.TU .MT@d0[;^~xqDdVԪ;k೧1ViYB.tmP0|ы-g"'8zi1$rG/AؾRӴ4&)Ĝɍ36;Nw[Щm'r|q=I]4׀:W!@euX?VK@;zC-ݰ/9Fb _}0Á( ^颶]]n7A*UFB3Q?<*VK;O7tC?fq_)2LF=z~+;6Em{vsYa!pJn=l޼s3ΰ .]D,'64$nͷ{cWDsPtas{(aj?eIHNjbjhG –^!׮zUnBtW Mpųs;{c4q846zMJKݮlMBhJ.qn_];<|j({\˙K^\*Qkyy>lASDSM@Sw`6X hﳧ;ҽl*ᄦ-ǧ'LOúN&mNd*'sya+8:MtF_|gYN]!Yhy5o| 'RCY4Ci)K,,QԉԪ:zzQ(0cW6vof!8 YrL.Ȳ,< 3m0XHogF7(/2}|3]g:o,TVBf;" B$YHZI,4NЁPkSwZ^Vo?8ӓ;fpT <*h!JblPx&}@!!<Щ4?~DM4,$id,Fftwj<ZP e6BNu`8^J__-SJh V@'iL/)_)#}$5hWW>?BTnVr 2 LפNwڨT+U+ͭ>}_YZZ OW ZY&?#$Ewzb3ଂ{/dr"GӇXXXX^+3W&r&Rp~TyI lM@5luJb!)a۾6 lՙ03d3߬ b!%x{abdAkd$Sˠ63~y^A>M~w7mgzlKx[ <ʼA硼P5f4/ׁo[ zRU]TkX5oK25\hOSU br["sakj)w4'XM~lp/ff6@WQP dkw %@8|ql g2VjVg-a5|j.LY*Ė71E]NsAFc@)S2ʩdB&|K %(D_7!#oJRJ| .> 5Ԅ̒$kҨ"dRd79i_ayk%~??ųE??q_, endstream endobj 285 0 obj << /Subtype /Image /Length 17688 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 429 0 R /Width 334 /Height 250 /Type /XObject >> stream HW c^֥!HM,CHh mFY YaMyXB t+۲,ɒc^սWןss~t{?My-G;ڪ4G˗VugOJk n +uܩd#](1,K 7LҨ]8Ce핍zԪUMnq>VT:r /}Ұwj-\j*:⪖i' ZwBXշvԇ]mtF[ ]UQCMϰ&W{]b#,>|GO}9VOiK)hcx<K;b^3; m6YZ[˭U4ZMGet+ pxz=x4zޞXO=q'>S?&,fu iC(eER ~7{_8rЙKCcC+I&ѳq |jUWـ՚_'Cle04RnC,Kű*k4}:M_TW?rdd7>mfN7k!Ho.Be,-$$FABoxI*Pȧxz^ݵ3_MN_ss3oo472~w&1}{twinjd$`᪞$6B KSt:F&Fߤ'YV!et̅GfG}:I#>ܺy-7MU3˹jV*\kj@CJ'ꌈYYl:)*d*Noh4F84huX,wd,`ѰG'Mu Bt&*4& "bnP<N1zS;dO0SBaƁ g0$Jbb؉gdH:YRԶWɐϨq}κmiO$'4D3Y '4uTPF9 .8#WmxPp8((yUj7 b5)IqvDQShPZHf!kf}g;)T=s{鑼.7Bdos!m?qd%݋j K5A84wu(q+t2%z av ( ;7y\ uUΙ ''g.&z=4?;z[rb<0>17q5be0CoE-FNJA?r1YER/F9-! hFܤpzD]kgN ɮp$\ڎ@$RUZR[غȪ;RW )4mY3, /TYJH$Eb:U!AayzIjK3/kѝsj{un n"bYcR lB<%7 Ԯ!1CI&몐e0 8Pڲ<* 7[9 A\_*ePx:fr?I EvT i&$lP$;TxzRjBN* (՗f'Tf2).#ZOWL Ԕ:-4rȜ5ʬUrJ2w*Rji 7O>_eQdz4.V~0[Rihf7B+dP27W?foVwuVY~jo;lED7>|gڛ7oP^*u; r HaMB2#aQ'!jOmj;6c<#LC.x%JHUTiYl Zeqe#s1_?mcYtg#:CP Jn+U2+UՖLR7NGUBn!nr -P?^"BO''=﹍ţt/H>I쾓ػ5E%FG y)'Ϟz𵚈 aMe{VڇBhgH8N?9.*duąJnBbҵOU6X.af&mvћu ~LQU*#F_q[bRJitr킫P/˥Sr`0p}˧<2,`&9q3^>XdZޏݽ_:O$=WMSUI :-({AC!i􏠙8}q2L4_nŬWJ ڝۡ (/Ej:RY=C;b27o'&=!+-;$&˜ WQJ6ىMS /˅M,9ަɅ;rXכ?<;qߪx\yߧ ۋ Ks9Ћ it@tȅ(M1ҩ/3I1h`'Pͅ8R^?IM25$)܊+_ vwO>U~G7Z:AՅ 1mCDcbFM墳u'䦕= M7f Zt!gRbƊd2F(_+9nn-M.7k fyHw'ɲngHͅ$)s2*.Pp\wva32,eq!{ IM՘< RJ'~nPBlBaN4! hwgl^_uT:5JҞ7 \ 88rb?60=k3&.uŒI p 8h,5Ejvv!B MׅPmy9I9X́-'7OݬBs~V<ao}=CS/PMBLpƕԅ M\&uɺw'#䬅9<'f͋ӝ?꽕 ӣ%469b''wOsH84{~`*$;i?o;fZPx:4HiS7O(O4a*Sj"4F\`y#0ɕ6ohofLJ4vRy7nLv3KWm=KƩ(f'_IVvK;TT  {+R0~PLUXnnFIVw:$&ɳ"a89-kb9'^?gpBAAl! ,t<2y8ej] *-lcݞ'~ f2(tP5遟yj͡ GgW(i͡ڎ$ݼBFN(fGơ1n#J)6zųxr{@(O!LtqLKIi7<6EݏN<jeFB J/uG+_w ٦lsDA3QLU݂r]{xX{dTfJ%Kks}]I)Jd"y#LTHӨt{8UV5lX'v XpwM3S:r(\UUB(e=ҔB&@[Ӎ:bG:`~F+ Y$M*pl$Y}$)\lEӹGH"1 Kt] t@4,sܯٻU;M/? ~vɊC2+ [k^@i11Jt)_R!9Jo,O^7lD7F{FFD<1B#윥!k.aazz|U@U%A-I]G˦*ZWaFKw51J.Ը@0L.L<>ot :rBɭ`PX.J oQ,2)6Ϳ%ԗoWƵߜ쮓;/e;jʻ֍ԨhH 6Uuw?0pKl @Lf 1 HVO9a6N8=@Ý99.39`ڄ- =9q :Л&tBqSze;KҊ%?dM+߀&hsE8Mq)-{1)vo !7K]f&tHнKť88y<ӛbȪQH%ؼq`tMJ2Rt2iN e_&!> rQl\^7:@&"-LGL6HFc>Z,ƩEN7;,E]Ş{zOg.tR.P1UYS #K@445 %}*]*w:wK&lOMy C,hG#_mQ.Qwa,AsZ8YWǍvv]&9PHI,S, Q$ ~GH=w IqkT1Rb)'#eiF?Jm]4;7)kr+⻿h{{Jn͸}}725ik,GKS\D; iM5M쾈)Xyio所IHi2!pݡ;ӷ}+#tᵡɫJw-~32d$ʙݩ  uMi&vDBv9 &s$-|)a#>l ؍.4iB6ԅ,Z/g,|61{ٽ_2ٺzhn66rZ!K~dꇴNZ[B]ڤBfՊk;\zґR0sM(/y4WۙN_)_5M2v{Ͼ~8}>|VtHgqIX NR; >BV-WŶrJ:U nkZ>MWBqY-ԋF8?C82ݛ&UOY^7+!D!/`G(z,…NK(M&Ev(*ѯnSe;eb$#KE|js"J$B$S,}پYBJ(Ĕv:CXK+K.NƖvz U4բ7QXeHi7Q݊ȥT8e6Mׅ槫&LE.$-**3,]rX}=U7~6LB"8]R8S,(TN$f\cF5#%*d 䉬)JV/p`OC~.̄ꂦz=>=WO 377& W?#߬?l9?V8"+ b=0e^Q!u]ȝDnN q;z%́6gn>~mmv̏o\|~ߍN_rݾwW*?MN'_w9m /"IH|S!V9AY<ө ͓gYYnc>,}pB,\~ޔr7$Fsv\7G)4M(hZ(VuځԲ}m֦(׳k٭uc61dt-,zݑI] LjB`eWmOd;3l@ $$FݖX2+jaF|u0œc!ր؊Ȟsg6xgܹ<j鯺ED h(|ƫ! )[nfA8v!I*27TAL`EE5W$TvOT 6 se $,S:ҩBnr,' ?8h2Z]VW˧2I,:7Sy܇|dn7}tK,Mn3E/Gt~9,kݡdKvMv-po %A 'N3/%F*TLT! ہ"CtߔMe.ޙ=faړ>_@sVD 8Y%ƙUN`\uһ@s-MҳýͭwCOEX3dY[UYjg/cy+m R+]jy2;;5E]v꫙o> \S!K M־U\;[7fRd %v0wvᐎ֟fn|YdzS+G>yn`B@hR ^>x:Cs (>[K6?-rՕ陯?; ,kyM>`*|܍>b9:pgF-JK\ỷZMyt=i45DΫd>%`ȺM]Be0:V;K{Ԅчotс38ç0rL<|NLLڻ9W,*چ&ٲiH`j"pCj 5Ȇ@q}Hw+quuuCs'IȷKlr>x2۾)/ߐvbA[^M;\֥,7ҹǿ5gh!viTȷv+'1ziszܵE%PDSCDX濜׼5 Dsb44نlMtN&ɍ7.pta`xfϔ Br5M,Vͅrj]8N{ hBsBf8R26qQ~:ӘEs7wk˻շ[`e:QB :%$v<7uy~tŽ/'Zw7.M+D*h*;BPY(Uk[k`8;v*P%*T:Lt}X ȹ WUTKńin.!bh b*B/C;M2^]J,,*kVqm~w~yQKrŚMQS÷Ru#IQd]Qt{P3T(e;E5ajrMMd0r2[ dHzn踸<;]4y<4)$JbT7t]7 h C [#(MGᱩYlt5rXy{WV\nv T[i>'V7[Bj"7yTߋv|aM9J+m޹et55{!K ;<: I @t_ k;u'zt8L t/rT1Q="F*$.s#3Gi͌e:z!M3D-5Md90\Gb)j w6BDLnt4J3\.76x6^?k8Ectqלǽ[GL u$eI 3+r)P_~st ӈfAB#F+Tpbo y>197 kKOYyLFjMh|&TgH{(`Q#l<98fժj1EVmi\ij}ڂ6캣;Wt8ןH<i! QT5#lpbƧ*iMo}ۨ2^{g^~s~2t.F#<*ȡ)[C֠Y/B;~>[e wI7V{vpƼNxNtY] m6|U\ "V<@iL hErQRTmqI h4CT]]P8P;,㑢iwD~^Hb[>nA0=;) k|@(ihnbh'Rmf>Z'-WբT@."9'<ıeJ6B2cU$i1d /`pQQ!M &!Br$7OM9lq֖Z ).UbL ֱx<`2Lw0#s?sh s*"Jg7 C^\ܟ)7k^'pHo1Cgp04(=Y__?(׃v-0,ܑO^y{( # qG ? PݙNn֟0Rz-# 8@PDÝ+v#whQE^(fxl MŒT[>D$½ & wM884w)ĥGznJ*3JӳUEc(R+4koQ 5x_'?w.5`}q  Wm?焊LgY>^{{B3HtMa}fM 6B_u\SǷm7o;Kԭ&B4us4G8W؞EEWTQߏ~:2 냃Kt_oʌ~VV7IOk,ˆo թ7j 9ˣ Eѩexy۶H9$, ۉmP@HPal>3 Q\]؎eWh6$gQYki<,GՉ[Ш92RIHup%=)}taD87'qh[Ω UVڠ k=[Nn.'Ipy4KB|W4Qڶ˺*PQe^j%lvY>LO" =<[DaHl:_&4!Ը:qBknoCӥֹ[7 Lߙ/$ : |`'2qrㄡe]>7_mRhJͽ"I DCD"_ո0O8YR1}mԨֶ#tiptpDIdP6ȑ浓Pm4_vUWʾ|# -EeHF&V2@ mBYunХj]ϖ' ϢȢ;dԛ|wZ7o+-7 Y9oJ0-_u˒WT"3؝d|\MPa8>.׭94<Nt/NF{MaB<\ U^hn%.#9ɵvECe1u(W,Xͫg4.{G"z02(0t@FgK4!RdSA3U'!ZK957_@Q1NfCp#;  =QLɀRLqJuE]j'ZQqeƲ/aiFU  T6N̶eՌ]Tk;BjeЩp@`50҆B \?ka̱sc__~;Q5UNOl^lnCX2=RMCh9Z< nzzI)AH` 0'r0a$V79|d&RG^Ϭu,4ׂ;^i٩P FCH$B|DZ *> 2ҷn_-7Q`\J@fE=O&{fwjJM*Ja8 e땽\r9+P#xzՌc5[J8;C:_bIAs c =<`*;^*q$2DZ߇]~Lh ;>WY.A%FOp7ܜ)@(*YFgdHuT"F7~t/` /H*goam8pyQ8*ZK޶ݾ{'VxfdH,榊YN|3(ʻwa ENe!W .BF5!wx"k71b^g F)ʄr?;i:F84T7B7}]cXqx>|-y,n+hKĜhkBSS#3/Þ^6BRM 8=Mc SS'ccEB}O:ʐ][Kb^.Ų*Ԣiq|ӱ0o=fZh hF RXB-J]aw]_+P.WF k{-AYܢ|Sqͽ8DJAVMKnC8!DH"F<<]ۢ"9TCE31d9{cwtS cjpO~aTؾnbs&M: (P&l4C1"a(ޣtqlF*KW${ڔ*)8N?}dieHF-pf0$ F`FW5 '7y:{}JKr/-[] cj^ۆ;䚶P{Úw}K]-0Zg`RA`}cۿ$Y'iF~z~zz!Y2|8av>{I"3)Qus3xz ~X_DWs1E?-51^фfI4UWPhza{DkF?ܤBXF 7*A>/ x=HƍKz]]G[|aE'dpt]yBL94 unYmڦiۙL 7`л ߅BoՊ5T,]S %6K愪5DZHCŚ>}ō͡M˫殍"Z6Q6ţEJuA:\*0;WKuЖ+sS7BvłYȶ%N0% p%C4sMp,]ЙUr2VtLͤ""4n4LWEG䋭LC!C\|}5Rp?S endstream endobj 286 0 obj << /Subtype /Image /Length 14169 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 430 0 R /Width 334 /Height 250 /Type /XObject >> stream HWCS/] 7H, ݂Nfb~B鷋7tcc#0e>!3 L, }EꔘH1}7VEPC4,_Agpx*eAep*Zr9@ZtUwY KES(F+hUuR|HYe, L7l E}zMRǪ"5[VՆno*v|v5vƣ%h*B/BɨP2 %ߌٲ}x`ֶw9"@OLf P\BcrkRJU( -n֣?h}x/?ށZ8SqU~Y{kt/$(Jh6d_MO+?PqdKkN74Hhj_2^oi'}@X/ȞV D"E op$#ш`y]f(Xn"#S7? U5Z| {" C ZB&1BIتP__UI[B]/uhFb$Eg ؖ!jHXt"xe"Cbycd~c gP"T!?&Q6Ȫ@;oHoҞH7Hgs>,g|_;It\s(S-M JlHY("QvBU PдSs'rO"Q%QZb8*c: }No|ēf NքaL|w땞CS*P7x~e׫«=n]QUl"dMծ)StqFbx k$!͘n2qli<⡸Wy:=ꢲUݯl4VxU03ˇi)d`mR]ۣOcg2tk&)pߔw7Awq߹W.ף"5D#=H]rYDն͠K4WV7hy3yJj`p[Uk7t4 _YhlX#ă&|Vpحʮ}Mw:7l,'}މ>!soRo$9vW>:}"w7LM~~zz.Ut!Me}5BD4ci%܅$7 zw!.5vL`j~,i#uHѐ7E8ӅL6#қ2*c٬cpo sVKꪺObHPY4CʘkYMb +T { Sm ">5]4 }}"rތw! 8_GTc$7#!є|ny yи'|Pl)Γ@ sHMBY]rNh.h'HMZ;E_]P y Ms2/$a`7Y챐YSeoCӬ'HSyGFI`;'Z|"HMMS.bf^)if)ЫxR21c80ͦ;_6],WNّdtӔMV+E @x3~;"ϩ*} MDФ6[ CVVsfvFM_E6ވ5]7v"DT!5BP  Mk+2gD3qn>?m,Q:$)m'rMO@? "Ρ o fV znB5{Jϯ ihz~>&& \r)М ֝ےYs3YW6rgL2w$-J:E9.~DOVބZ% 7n7H_/T.߈{hP5?5jL1FSnf4_Wl8|NK ؔa܅0"ᯗ-Oh-//v(--cUODv>i+>~*Pw[gT<;qi1͛*Cӟ՟sN]L>^FsS%j2](DwwX>CBid4ˎ)=/n,]:pvϋ.~`_+>b_ʦg :?}tSΥ/c|ݻ|"Ω2{wshf,-d4GG;|Mwwu}õ]E@qh9%Mv&<:+ꯛxȒϾ׿] tM -0FM,YBI7p*T{|CeUt䎨Wm叞Vlkh*{Ew>ۼɋd{uMa /d:*Gd4- !}ss IM5+rT(_ݞšE# =.uHF\jvab&50ܗf[U^~q\`fFx3DlVњvu ԉ !)muc/amD|KJŏAs]uh(zv9sη6ceJ0< ѧ ñ=g]s[V"Wl ؼyC*@AHܡ&GsS[/7K@a넘$RCKmØMḙ4kkѐ۟"Kg`. i|({2[79Ѝ K/-ySpP^Yl%4~b\&O >|.OP*:Y )3Ni{{{/nޞd r= 9s[lN wL9g:n_s#Xk v/$} =qG.;mҺ)t̓:tT |&4P<^IRСobͳ9V 5 < =cϽ<_ԘZ :+75OK9&$_T*zUKchZfʑIsR Vf&,-i)~UcAO؁&\CrB} J4.?_u!56ѷ>x ;mhI'afrӧwM|}\zOI錡#c6_?%lB]VqqZ a0}\$P%6WvZ| KWC>%5&{|~yFa νF-&BK9KBl%g46fVjHJOkf_Ilbuz5Bt2fHad: ϛXrLG( ڤ9oÎ5! $ f:_`=oҙjޱwn]H!cTǦsz/`z҄CN8NLw/ޓd9ٳ:!%Tch&!@'9Fn Z ePK: 1 :*JToz~ Oq//.2G{qM_!hK@&i~zA.IvBϋSk Ѡ>,7 ޛ=ܤ3ܯ0A`UU:ut\!?3S+ ޠ#iث;ׅ) zwFO*9zTɒ92c_!F2)bY$J rrd҂cu47h(F*8|,[&/h W+w,KU,f>ґ;NRy%M 5{9~|,ۀ\hqٴ 6Nq;ᮃ΢xױ¶dM=0\0Gi;]M\](j#ӄV׆n_*~T6_q< # ^]Rdd=pZ*=ucGYvI6fŋfyʃfTRM zO۳q hb8S %yrUC Ɂ:@`,d4?!TLǯBf(!lH814 foA7\ Bu5#^@qd ̐IŌ$bMvzꮧAU"B~S9|7CͲ$Qij I s%>L3Y nѴיMҤmuYY ]d-Reι=&zV?G*MtU4Cf5)*3yݕȽjG4qju3b:ۀW!! Ɂ^M|s;7e|#&,:ReȹuB^S79bHG`סEZ圐7a㹛G-+f" e-#(B&Xvm<D>$tz; kMrEt˛{ܝ9u VM}C7,,=:41'AMlU廃t}tV4홿t oi1҄_ꮉf0[Lsj蛰t$)fib}1V๎| 8Xh_teE#pMM!]#M. Gɓtw<IVFzq 't\NZ*axx-D(Ld/=*x!nu7RYttq̎ⅲYXAl:cI\ߤ_QGR?Il%OWP"?Ihshw(#l+~aQjhg˷i;ѷ=އMB_9D%yλ),x9ɍN1Y\Ft.,H',d0' JPàDB!JѠ&J'4~$ߠ "|Qs4Gx8Cmtqo7fi0`99E]IB5WS/H}QE8!N[J?yR;$iN ګ) 6& :C wt{tS>]5.Π+ssr 4h79 o LS?[-nRz -MSlXCnBS9B`ƊOBTTPun0tҸФ g4 \GXA)/Th &U!iڐi j4[ 0Qy6Mi(4a&DӵbKB3MnYH![iT4vh LkmmDoDA} ȾPGçDG  MT:䦅i4AndmioЄ 4GAsH=3UIt93+I;:<5h_=c(4afpfC"("wDz:dH>~2$E:r;+F|3%L> N^ Y;soHmOI~Ѵ*sV*3_~9DͷfB`g#H3Q#HǍNP0peD~7CuQiOM`B >Swj7.d {Wcɑn~L̓PB+37 o)4!M}fhrެ/|&}SB~7ZIQ(;o_mͭ@B+#@I '?i,DVGuY4G7l 5UH'˛O7?4+E.U!?c[ɖgoo4tf/ciٻFȹ4}RϛXwKSLjJ8;KWOYa]զ\]\G)T+UYҏ?Fs#x&pR}3~24;_櫭7 KѪ-+"0x `(-Q"6ܻjf0/=`anck~Q)Z <K]==$)y<9usSAW𨍰֫4N!E4D2BMM _Q Gj`VgH485 D/6kݓM~o>JFB ivOS@ T@A4#AiBDT) jd6 u)%ߜd!@9O[^M%PAY{Z}|TnY`NՖnSIU9[?S_sEIMo^[P&KV͊=ҍ|HpT=).M6-Xe@<;dE:o4: 1:ԥ}%0}Ha?>m!I8 w;5ϥH!D!tj ?NWH*;N.JS%G?Z4]!A25`njp)oz&"o5"pHl(Ocf:K@ _R4~3B n:@ ;&h8Z aelٲi('W=n{{Üua ^i}[9`&GHug( U)UH¦AW @B>ad~-0uFI,qGJx6 Xi"&mMClA5n#HJIդy-W6Qt 2=$D]&tXkl&{+74S6CMWf6hC7ېNrY"8RYtff $M Kl0iMdDEٔ&|THl<#di {3ҥɦ.'&=t\l"GT6kDN m`өB-@` lf!~]")l"GW~4>56~\c {&^^,Φ, (to|o=Nvi+:i7!=]P;^W!ײPrs$lHoth7\e3BOf`w "yyrkA.Ν{Y,Z9Bc3:vǧ_1B(MlY(9ef!fy57weBI{sZ DSl{3X`xeZ *t#H&X<>4+޿;G7QU8նTM!e.Lt"b37a#kM> ;UBޮח~*MokbL#=ou Y؄ᓠ9kMlf]$M1*,5Xk36B{Eo7O\WH9AftH:NZ*$ ZAtm0oAxFnzDZoWfbE:ڬ̏S 6&9jm녘:<Q<,yA Xf!eYj' Ua0&uRhA_o-'Lk^ =e7C7CƩH6o@bi"kvoVC~cMC/c6Ajtoj+9V.7m;>|n@bwJ@~D\7Ɠasged^YC|sư,^C3Q""gJBr1bXs'nvVHQMBЫ 1J;JKo|l$&xc"SIM-Mgm[|yt.ppYsvFe=}K &o41Zi7w="6ZI#:Ve.eFG6HlYM9ZsM̚ȓ:1-sPXm"A$TU/B5ܛeob1[L6HDMR*o*tkg8uɾTZ,YO&îZ߱=JQĦ6_;bV%˂rM{*jU!{ը"7u[iUEL[SD>7Cb?v{)CZ>_盒t+dŋ%Tβbޛ':WHU"&7d0* ꈴ[͓w %D5C7-l:^ሞ =GA h¥YC^uoLcԲ'Q {o4}ѧw3eHTzdY=EQw6/ƴ(6\sۨz[-JܭtЈL⛓^i#D{߶-41_XCh|4;!lF! ئtVgi`h[bsxR 6Hw's&v63.QʦM^.llc%)[bs՛H_S⫃OԊ O9Pn<ٗ`#a 1T昤@ޤ?1F^-8;tCC+o:Ot{|i|7$H~k)`W+Kha|}wޫ`W|Ӵ o[Nıo3')bHOi Fx7<~.岙 >~W?<;?]ӇTw=ro/.=1MUl4M&#[o+7N7IkB܇?;SOѱ`\lzⴙl3L#=XO ^zvد&(\Uh퍥`Rbq. Vx R_* a>\1IdXi4}*KZuէuws[ m%l9gΜ̜3SghFvN C7N=l:*.艷f'T!s{ahpٛu*_2gg/8|TuU!%=t=Ͽzx=1_=2zYZ4AXRVșT!C6Cf Nb8X&MDrƣaM3+oޒ&73D;$ci^N7{݅WPz~3sF@w!.14+Gi02Wq{R 4)j=B 㼠v!;on]{h%zb+}{ښ?'GB>&YdAGFLlF^8khU&lMٔM`+k ["LcfϢ =q@\_^|])f XWz@wuϋ(.tfHhֳ7EF*#Ŏ5cSGL0i(+P%h*;CݹY?¼'$ 2k7u#SXMO #_+ 4fr-SHm)^ݏ^ǂUIn *U3FWQRh?֏$Ks&4}pRfs2wXk$^dau.h%[ҖٳmfR+ UR%IEL-_ aEl7(Ш4NL7D5ʹvέ }I#ETǰх @gMl Z5Z|#O u5AǐfR)j2&hzU&\\ZlethJCm,.Lu.PltH8fSK]zQKnvKm;Z9eۼ{ {Bdi;5QGUMΆ֏ TD%6lF4cUh}t|n슺 "QLh)iq kh1 ǩ}5 BЬPbIoO%hB{!|tEHgAjcinrP4C*ҝ.tmZ8„mR&ؗbpH" sinҚsN3c]q,L KDPtUB-ߠ [iO[6w:.JWM̑s!g*^O->̧Ǘ}rޚ z%04)h.N۷d8߭vu W;ӹ*ġ9̛'\(Lo ͪ|Cciz*v8>U=iKWv`#4!j0AM;7FV䯇\D"6i P3]{ 鶝:>rɠPlc{{}Ut|BUHGf8>4whb=7xw2@AsTʸE0D]#%`67lMT;]5+ 6S&TOPگnJ F=)tzR:.RpdRU(,|SbRj@`,' dyլ8bRk+&-j%caMLhqc먦;76V5Qh8ib 4c_p8{."9aqh y 'O_0y,`{B3EV+Zj @VC~=͒xKl=S(2> stream HW_W^HːMH0$S*]խEbW( bbK]k>m?{ޙp~o9֤P֭w ì56̠: DXmj4cT 2kZTlQeUr6EDtpDUq4 o@fOEm e )5\˲.Y4Ggpz .feMV]%:,ӗɒںlE- YMT˳٬f~DwJa&J&A!r_c~m@8~w` :Cu /?QohՊ]mY${{X6ӆt6Mֶ-[Avcٲ 2!έˌP[kl=ݡشs={cC?;f١#GIf7}'ǻ} 5Xc=oc'~@/SȑtՉw7B|TTn_9F+ W8Qʣ9 1ͪlo㛕U~z^ƶwwv?VScEgvUK0ݛa1ZEt?ȋ ~D=0>ZjN Mw4l8\pu)lu^C#_f^fJl.Š*lKDVs◥E9[쩯f嫐EŦ\%Z`)Ky8$d/3*ir6gbcvJ9&,HI c,Gz 7rzyPBΛ9^( M[b|qNH^ >o‘N(R+{ʧck~%\AR5t6At*MS1Ĕmڕנ蒺6iUʿlv,.Ɛy[z;tlJgζ' xx<_@xeFӣkeMĆGvD5؀#[󨋤yV@]vXHTF.&Vr MD6AJ|M(O&|9ʆԅgSWP坎E&ijy=FolD[mߝ=Ґ%`Z">wyebn^xmM{GiUM,olNMN7Y}Ut͹xDݾ( !M}!gVR6P j{[J*q7šXGf3*Lɚ 8R2XT@̓"#Yd<نP2I4H$M`BJ&/HB06 "K-`m9tl`3r QgrX+mƑn2JIt4< MR!)DG, yC/ygϦlyGʛx,~Txo:5&#pyӈM2le\ U6W #it/K lZ6kC:"ݠZ{KKߍ+n)d^v,t1ۦj9ad9(ܫPާˢYۗeA (!6yMi<MoѷNFd}6q s-;aA = bIlVuSST߰vϦ\R.~4ʛٴf. 6s+Yc/|UB覍o)7[BbCB.nbM[9u-&П{B!9T ]ri'|kc+t2=@#Zrɿ lbC!+r6+0Kু[gHgt9`ڋd_W`FfB1(CYqQ&ȝK'P6!mͦ|Ig G-DLȠfjt 7M˟5Y|3*{;ZLcF'fDI.&9Mr$G$QC+w{S m|65fO1Р :gkHgǪE9'avs!䳐o" 9g#Aĵd*Uw*ϯ-Kr/]$6qL,߿ل#=^^^Fd 5'ٰkDSg֣/+uv}Ŷݮ]gt WL 0ol}|8<6ue4~)95|.tɜͅ(++;&SחAdr6ͽ?y<͡6?g3Yw-/wxX_|ƩʭmK[uv˓G: ͫW6u[Pk}blI 4eN҉_w)7ݦwRv55%A23S6.e3=8e$eMC3?ssߵ4:m<[>iq69g?egcޚ [gc% :_}{Fl'HM_ECt U>\wlۍ W/jxbABv+*+^]s>iWX {\b.+eilp. 7Ryp˩o?^\\\X{nf<٤d#GVoDG|\qUZͽ j ɒD[;Kh U}Vͪ*JpB.%!!%?:Qke{9sΙڽ+RӅdh iKЄ,cPhRf!ݑF$Z0Y7E+~رHGL)?}0h.|unCzZ&΍@5ZG7!mvHopdyz4Ic:("Fprp"m1?Rr_C`: ֺЋ3wTy/f PZ:Jj_3N(mbJsձuۧ p B|]WMm$W6R:ӝ&h9 }C9o~t4Pt~9a"cszfs mv:iPdVԟo.k#㻧3gOIHjf%áiKFgv sNR݀dr6oGmN~ً{,{S 'PV H8D Q789Q:}j뢊}IM@lxzL*z4)+:8uܾkmۉsFӛU7؁?ۓM@ԏ[B#o_ț\{ 4 [.4kn4fGhpޝN+hn׬s7wh&IzeLJG77yNda|a7|F8|s1B%f\ ~PL4i97o&QhHϛUOlʼWS_SC,iXѪXth 510hO I4*$&hnhB;oPѤrTV7HwxDdY8f_S UvO*B&;JBh73"Ť Qoo6jzB!MB E$ҕ*q,l)U(~ɚVM$ qB 0{bdrxmhe\-BI4HFpx}/LMMC>7I[T70/7Q6ړRu4I4Pa Ezw@*t-2TGtHZ Q̚pDs8uyJ 7P,cB,4mB301e& j\fހwjp4}K7_^KX1:C󱡋L^m7E]f[2Yd3g¥ f @^F8NG3&*T'"pԵe1{@:ڎׄ6d*u3gz]. CCݷnYpipS ,WEnTck$z^SlJ쫙,&M^_&W |$UC*bIb4 #b~SrrARaeSs\BW6X O|(JYx/DlgTeN"}] >\ЯC(4幤tnr֊9 Ӌg9SYʥ*D[Փ3]#2BstxiM O(48EG[!Ẋ⋺8(^Hf}KѽwR t*Hfwyujd(IeEíoCگ} YhEݓ~AS7nچλ⠑ov0͆R7w9nQovU98:R{MefT6RYmdO BJeP9S8TNUH G%93L#Za(jfXk{!Rǎ<8: NÄXϿ= 1#5lGmt%ۂ*K!${J[ՎGOF& w :d,t[ ukAVIp.I$;ԄCۚUEO@+WDA[1QEb?ԛlݍwsQ5;7OגN(|$*(3D[=j)hJ* :&ߍON]ES^&89}mL-Q.4_˗ih=sIp 444\~^?QdYLHUƠfMs5hvL̮,mZm K[RKHP"!N#dɚ63g}{CS{~}y.)%UOuEyBMh{6W=*д,ׁдBa7 E~"M:axD߄K1M g{ /hF"Ms-N|#z:t߄wԂ18S^_ M(;GNMg&>t2v 9ӄ&Qy 47E6nDmiGp8nO.f=Ə&U<M7֘#<,S ʛ ٙ^_#U#p$/F\2uɾ 8!=o8f_+9aYj P*Ċ*^)QMnK|є~SBۗOnڙtytx|@ Km7޹¥C07!yΓ۷ff0 &T&p/B͔}TF*Myjtt*we&,m֎h y3s1qBB4s MˋX`XrUiVO+ˑ ˨2peFb>Y~54]sM7EbzVoBt)oa/Լit|1= 睏/XF4Qzh4+X}Y7so[H4w\s_ Mr-+cX?to `EQϭqI`k.??;`<+咝vԋJM8hN 38+/tu==o MH[L&qr%UGE2ۣ蒲,/] $Q@ӮP(eSN%o(4I/Iʤg=սJ?ʽl2Yu~[~P*)rz6Oj3V\ٲ3t &M$ϥ7ĩN`axqWcmPʯu2SI>rgk{s``!I>lYڪ~+u }S-܋A[AɆAC$5&v$_35'p&uƮPR*lz( zj&5 m$v=ܧOpVdRe4]tIQEW 7\M!2۠f0>. &us HS|^޴52jX=M~݆GI=vH_FsK29=E =nq dM0+Bl1F:@}͕M${ D{nc 1iU33s!J$O#j "%AJ,~MV x] ${iOf"^렘ft3.]?gz7:dSf' M0 Xiޫ&&t^<{w*iHW;ޒ}}PS|ϧיo ~BYZ|{1Fto=ߑPx&Mfe72{n&ݙjhy~$5SB SiW 9&ۙј/&)LМՖ/d_@ɛ]Ф4J!97ehz:$YPhVMך?PzӚi ܼ: M4怉W_>M4AG5=ٓOr`d7lJ=, 2+YhRIP#LgPIan5'0/uQN‘,L2P#vR4Ĕt$y՜aTCH/#ћicyyɎӚ^Mj˘\ނƤjrnfiQc~qnOD:֕Mfso76^ñ6MU`㴸{(BMrhkŅB0@ĄT@zu7 ȭSه~0EؐX 's\OA$4ĩ xӏC_xC3 $2ئ+ /e$8ZSw!Zvlǁ??w C i@Pp{6S?EGbsa s 7%0[in)µ gˎvmE$Zŏm,klfFz53J\m#1fCa͔in))bퟷ5@ ܔ MĹ}2LwKF +:FM#h ΕP8fudi2İPD6:!jvh,,X2khsz#~] x A>Npԕeʭp6eτMuCuT!ݨb1a[4lfd>.t: -~p6c[b'L::`dm[I%nZb6eTw/n幅Flf6Ĕ=ʦ'l"KD[¦,̻N{& v !:cpƽ&^感سM[IMǧ7bHHj4y{6^-d>~~$bwY>7 g'xs,LM]?g 6>Yk?L؄5fs|3JJ&:N/ :6}ͬ٩ 5_=]b 8bh5ݳ̚K7zMplR C !j3鱨鸑pthUդ[{*Tg{6:6}io&N'ozせ#allʈ&m/\%eӸ IM\^BJRsB ɢV!QB4DM76̾ !?k q:wLrc؀W^k?\d+MhbCW!9ѽxцk!lbuqhlf>.i21zE4~WAE)]#r%0sƦkLt+-ѫ0JrZky s)@?_%a:ׁͼա!.a| )о}aȐQjmtk+ ! `ke&ѾZvå-uۮҔZQA4SDn3Z#Ϛl.33]> <6 %dHNos"܁Ucc2Ey)eEzU/Ao$wOyg l̤B&UJ#|-&;{euݿ'cjz]WGP.Nvj5rFE2GZ8G°r&f~sG0&MT7P{~ %I@A2Qa5T-ґ-hw!9؉{+ҚuC/bbM#ӃꢏfoH[ Ϝs3%,Gij,HIm=w+Y1:0 Zx8d)dl=#R!"ӄA 6s{7ѥzcSS_M0lU,`34Y."_qrʥ*u jEa՜D`,2M~;4BBMW2{ΑW>zvgd҉RdljTg:-YэTVJEm?jl&P)LƦx GQlJݣsOdǦ/6}35񧞹K'o|z7MBٝZNOMV2)HgߌďmeF,3]ɽfzᏟO<;2~ ,wlƏ=yt^)<f73}eƊ<$%7Yo*Ó3'd9;oJ:6՝K܅.*U'⬾K[C4&p}3Qx#s.tFu>'tTi2RS $! l$@n9ѱtggs\ ъuYC#:o-dtllCPzX*](NVﭫBTAS3g;5.d*齫z۱c35-)C[ xzP fA-#fʹ_K3x^Qy`~(Jo߄&DHp9_Җ'Gqw raZfљW:b KNx )͵=lBZ֛nT!IdTMk-»Z+B2<2_3lVX8ʂaW]heTͪEe_tNMoA| Ġn2{\:&7Rn&\c{yM4sF2%ƅ1)2BSAigˍ::: Mۘy!R8y ]60emG:b훳,B [Qd=#e B$ Uu)T#&V,UrlAa za S!\0Έ\ 42(T8MWـyh*ĭBSܳ(4a;(?\ kUF^Ae~^P)W"+\[0I/hIR%@AgcjbZ"+64u~{Ҍwe˚hθ!hL *H4q^Nax-uD`lKhb0K/^\/T^O\#tMkabU|, mf3UѾ)OM,lɍ:&hj̭GNW.f~(Iy QݴݷI#3K\EBh{;O7W'υD3i;Xku--'Hb`8W_$,?P5澓0M{}Ot bsw{|ߍNh&l +$=ARojMe>5bViql::*˪jT/ O@|&} w&Nөw5%M7-4}F5znnOKS_>wyGp 5}ɽ`2%1t~$Gk7_Kߗ4~>eC, hh9һ*aA. ԥ0 Db0Qկb vѸSe[# E7V"q?Em1ڤwSt+^z7ѫ,[\fٶZvRe}|,̾ (nt33V2sX+k5͏Vb -s/Q Y"(抚9A ubWdF^u+7Y|YAS$3EA`GaQׇzS5FUͷj-QE ȶͱȑFm6l1o/ h3l4[{+΀kiA`x:"U#j3=Ld>͎HYM)X)8hۣ*̂=Է9v]UD@d2smMaq5ΚPC Wr$SfD|>(JBs/}ؕOPƩг[B+Jƭ endstream endobj 288 0 obj << /Subtype /Image /Length 22704 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 433 0 R /Width 334 /Height 250 /Type /XObject >> stream HW[)-ХQV<[lvǎqN%Iq PISOcf :6ם33#GcO_6655676:YS5yY)5Rc󯔖_o%54h7qCO6 6VYDԈ WUUըSF^sGK}?(kmG4Zr2/in?N@w;:qZ9ku 9ļw07!t'-qߜ<ѐ}euyE2*ӡ;pzfcDN7S4{)J/襔V6bV҆^ )9NGĊe9bO7(%l@ N4x:ajU(ES!PJg߿8yG.]0+_GW.}p?ܸ? mB:؟D&%}`rf'.h._ݿi0)tq=tԱ]55O>=?vxן;Ogo߹vO]}2TwkV/9XWkβL˲5,gn4s6B7g>_wW&?Ʌ:}-;ŝَs?s07C>uMx_NUȍ.ΟU_M)+BTj0S)}85J⢞LuR'4%O]zfUͮy"̱1|ևQL3_\UI*TNJCR!#Cb`Џ~i$v$S!m2P>Qv:ǝJSPIkNzIFB,'<7מ'ԴMM-^ˬ8d܂_97Ռ_yfHzjYidEhH3t 3#V n!C6B i˖`ZٹkFST荕mdܜ $f\~o2Y 3"$6bLPǻKuBm&N>{dThIUl{&s#a` a x|`?DFpJ{±QsTpP.;bi=FDvzӢt=Wj[RR4cQ)w;B;CF6D$ `DssH@L端([[0gNM!M"] "\FR \d1`*n)nN7䶗yzU<)ZC"H_$S$Ή$kk5RŰLeQűO [K<hj-4D%l pR` ] t)9?Ed惟`t%|Fr^VNWhl/7Poj:gEI U,ыp2 fn;ڲT̳אjSrΏ ;eWPXec1-HԀ3Bq2 <6"nwʼ1mM-a2 ,oD-z:g 4 T8wǍ-0ĩF5¢Gx>/LPSԃr]\N^GmcK8^6Jo%)إvy%c`-D,J8'p&`.ዤI}cE*-T$*fFo{g;̪ݹ7v3(n$*Vj܎;Ύd|aVmo] Pjx/qirjԿEq"op~lUB^| ɝlC*6,\:>~as'n}7uj׳q?;qtˁIx<!b~*]r5r&t ԑ~z{3{?06GG?yn6xx}xNOr|Q|&͑@-}7ݷ|j:PxY:}Ҳdd,=w16]\诌Olٳcs3G^Nw,6g+^wސ. MZK<BIfq8M2 fO<&o:NUȿ&tRt(ەn%QD[F%ho,k߫ƻOL H4%d_0ؑH` :pk]uN.jR4E|b`b-+`d#.m ?:*e%y4c-0,ZkRH$tpihMj-qeYN2-yɼ5(B4qcy Fx]VfP!MK4֗W/^EU*T-}B|'`!n(h1 YMoNc!A@KЍ sW! JkƫrnkʫgՇ/T I[+S!8XVjՐ'$oX"RG𵆦Sp"ǩ EݷB.2rtU` ^sAB(@`A;3#q ąП_%j^Rhs 86#[*IX@`p ?Gb;W豮Jπ956 Nl$\`HrJ໴v絳oFX$m yCj4Wm((]\q^mfg!$*.,f  ,t: x?V*u&1e1UV G]hfs_::2Uyv [1sz6T҅pdo 0Ssrgc+F℺'eŭH= oAj6Y2!I")u؈A`nauV}ڔ/;uOgY &83f*p\)"|6xYBb#ݭP}T7u%f1!CKN%#dv^*AedW DD/wY" xٹWCH82~Mrb!n~ ɮoߖ.+on먭jj_z YŚ*P*v履aN ٍ!ec;Ada"6BOBNt.N7J q/>2nXziJ2 9-cTvfcTH*w zs|M/0#1RS4*fv I'#zo*VI%dn-u>ֆZ Ԡ2!Mxf"%` }bÊ1ȯJӥRFle6GtۂE'PGe:-PE"g 'b!M$-Ϟd~@ 7iDrlD2@(y/jfGj%cYT**) hb9&jotXO, 3KۼZ6S1S .7_~3Ы\յ`W~SLpzI g -{E|Kʲ5%FXH`݄}\+erԯw /uOt!XNV޺7Ud>wZs[5jt5ѳ nZA3sZG9|Uqeo#E,z=\nj<6"Bf#a ϑL\KS׌;L=v&ʅ IT|]u}nmfAܓѿ_ۯ\4]A3^h2ҋW#S˝_lOdZ<ՊO{ /Y:C\|`PP騀7 Vha(a~Y.D80<Ujd%`h`,D7+SP燉൶p˙Mwjg!M.`xe|nLd 8_F/maK1e(@f݋L&튁i_,_=_V lG@ad҆C,~l3D874 c4ad~BWxG`;R69 a8S88pƓdD~sxSᙥDnh04t,Wt}P3d#ѱ㸺Xm:UH~4Yc4,{Z. a?5dd0"p*vw&qjd邅"YȲt`bB﨣BנXxuBfPݰ M W+2v ^G `K8]se2;A_t醡27Ra.'B*L'N0S9 XBO|6^-m#gpQɑ]PKttԣ,^ w$[Z,[dK/#;o!4hO7r֟)?5Af.L?@PExH)=;E"FBfxtGhuRמ"% #$'  CN߇v '߮]Q+&%~so?g7dVC ;}LJbzXc.(j*nnu]/dyqJTI5'FAIxg!.]2( PGL:ֶ{I0B S\HRe>$CJv 4# o!1iYIJSqtPGjD= !^ȢlL CzYb.&ŢRuK @18%L3ܐH]ږpIHXN oÉ \Y:J'^T>wy_nQݎݸ5]p$Kx WL@1 c'dD u!L`@Nbos:PͲ!=w0Er9;R4VҧK/$^1HNk:4$[q]3UU^zZc5)5IjUYt (YLGH)\VE_x}uUNt.kLJ(f$Q'%ଗk%Ӗ=̿ !ՏHɩ_룚 W$ʁ/_]i"wا [Xxxx~Q~q{$}4X n&4h⫓SgfF0nB߯-VVMB)qS 춼Pk%ӝ,ݹڙ\ox\<ݥs!#)6x [..>C_ ~QəB!TFְ-ߏ, V.!B\wg+\HMg 5fiT~{}BO-4Ijp)h}qp 玨.YזK{'z9HاWtx:*o+/hzQg?υ"a.$jǴ\Ռ5$CnB<^7Ëqzrv|3qy7Fj[A{\v`#d2q-)AM7-4:OrpSz!Q4?BOc+ 47hn;?:|o*><O*MhF Axpo!9#V).MwJyM"sE.`^S7QEO'LI^qؙ $^8,v{]ۻI.6+!X.DݧT?s@rFMyS䢩CVqsS1gqsI!oxBZ_X\83Y&8Ojjo~>V8qyU%\yei EڂpM gϞuRgW/_|wZx^<j:hї[ ٿ;կFq14M^~D)QF*B"~2PfhyJ3čLb&0cրk*ޤI/dtߓR&ڲ8?(m2/(~!7qدoxݸ^GRӭp49*Ovo;/5mhqa<,gf 1GNğm$_0kvMC# jWeHGb6 Ʉo~jVHӫQ/͊n]qDz DDPۑ;RB.=LX+(ѻŸ5 E 4njte¯q/dk:[wyv2t% c',*H+Migu ]0f~j)4sCьWW{ X)<WK9 cᦑpl%)@or9p0hnXLXttƛt)&dqYO)tl2H9Ieǥ̕Q5 N"n-WZ_! =Os &m, =j@ާl s =7#!!vțII֐yB×~ MB8 xSr3XAfec ,wm=@ͪsvskܴx,Uy.A%Rt}TAp@Sρ8ROϨ4s.s HUT]v6nY~7!$m ApvY_I:JNI$) 'lb#nb%;9\4.n|&aEp[^AQ 4Ȫϯ>&9$)XK.ױWz]wEoEW;R$OYfW ]ɅBgj|VⰔ(QPYԉb.$I4,C _c,M/<`D'n@b9$ 5<%ڼN^\"M{]+03Xa7td !6/P)J]v%K b16.FnZU=Cs1<]8FWK24Dӹó/&*>r˸wKME34&JHm 1cLT487#|H,*g zc#lvwCx鄅7߁&+2EiNS+Dl-;,/@z!B.;moE D|ZܟB9~*EP!!g H$# HUt.)04i].JA6 eW癧F!vq&&&&gh{(:Cl`0OeGIT P,`Y Lݛ_|7qi>NrPj`>d!1lX>MDys-[$NRMN؉,tr:M#4{W=,ݭmZGk\ eI-ˡVe^t{(u3tZHHV YE BV,cKh b NmzzGwvw ] ˘>rǘ~qw,xsi/d$tGj*Ӡ0Ȭ"b@yYHMq9>Gy%E@Wɪ*3o\FdRk M 3gKR&THSb 0XGzњ5[ #2'}\d:%^ۨWESzH bRO2I̹Ze ! ඇB4B x`+SzCp^VH1ib/'/hYHuA2߷b#&99BR`n#s~@2#Y+#VpϦJ8Y$Gp8qS $B "}qOTǶLgp>elUH_} *""6}Ê+oSݝ{!Z?ԝIbAD\DbK >\EW$F׃64/=<2͌rڹ2 𸄴,!љ6,  DF.w߾ϏfwxW,$"pO 727r[7Yz^wz-!CTYq䐲^cگ_]K~mt%/zn²Pg!q*Iw:ݪT jӕ~٪ou!a4{NceNT f0Odzie2jz+xG7l=(<5 {_]ٹw_@Y"R9BSW*nϕJS; Wvy.o%Mܢl4A@p]Y[&&#**iCrTH%=ʗy \v-Wv8qͶ۲+UF{&Y9!J1P;#؆0+6Ǖ=^i2 І&`Of JV=?]Uh ]]]z~o,&w]"lgɸK-唔ttUi爧&G?*hd!Fr&M D&AuPP BLܙge2$C}4 .?6 Y۹k?A:","鈾hu)[k M"eवcm&v`CO7Q$% +gtw\waawxoݚ' ΅Eh~v.s!} tQx@&GS7m9jL(})wa{B( kS(*rݔJQ`չL($@Qa-f_\;ާjJ.*E| $+dZX&1z(Lh @ ԾқXn; %CT\'p0RD/M LieAD2$,{FM]EùMI~e(?/.!!^*2~.* 4PpPb!z9aqE!r}n_{F!W9i`QX_Ģ:^(LJTmxٽ41bFHZRȪF&$0Ӡ);;ԶGY)$8.*)hc q"a21|Xe<6BH00gB2i+$옊By`H`DG/fkhӕ$o, "_KیdФpT(K巽{0njm/Q &p@f2tf-zPf&>> 2f:ӟx\,O| _ ;AA0pDec! ɹtq&5Y`! EjB3p ŐG~(tUU+Abhc7QVH'ZtKQMfw[w˕XPgݬVQ)[:#ڢ0l:rhԘgn4q۝Ac:gacx|v<F™`lM&pY zŲh0rBKM+Ԙ{𝣜]Gdw'?wmN׃W+Jh;FoPY-z;JлZ(T76Kjq綷W_^+Fe5B4Мxջ>X F Pfp qѮmvVDYڦt?_qGo> Voa;D* tf<B ZyG~TBiK*$09?䐄AA0 m !`dzs}}xMoncxq}_4N7h0.39*`7,FK 0MnE'S[3m]D:bTo/eeYZgzSey\U9Ԣƌ}њ#<(YR0)X(c#R"1.MBf^lL1RLKuM` ~ iF @6c5΅&,Ht@+r!Yh>bX,`a'_8A .֛;\X "Ӄ9ϑZ\٦3:R7M}׬'B@F̅>Sj`U:$XHB*ic f3B"}tQ72M9mf4, s2B#{NDuք 95A@5'!px+|%!ڦ3 YQG·khRӎ; >DrM.lG.d6}nfXG ls$NEh 2vF;H/OIʗz4L6d`o4um2Hkt8YJ&1N< 8dDzzwǦ"f!M4 [%|·^ML` -yzuPJ$=8+bD2fO@G/Q!0ZQkKȸ=#f6)sN(RZ^asz32OwUU'c(2uH!FdOЖ?Ϋm 6 0vT-KE=&܂=@O+#$6%EcQ*g -oa+PJwQYjA]|69*+mGyEûvt0Gft1Zha D1 Db4@q qJW,K?~ gt 櫽,*^9H0wf1Y8z2Db͍B\ih0:CAVB_Hfefc4vRe9u;Mޟvt:nvp-b !UL$EM`P-]&97LK5A U_m?r3vƷK7f3|Љfv<1R ?p[*#TkbL8Q۾YĹ4Mqscz+S]tB:i@AJ (*!],eIJdpP|zz0#;.͛ ].3tےY_d"ԤF+Fo>34-+& ]F35>WGK rJ%5KY*^PhGpx6жIv8+wVdHU珔3\<ɏ@#7RJWḺBU^_.z]A_.}2xQuv],jq9stJTgëv\7%?u[GS;ДڲHLQ:W+"|\DoBl*Mvظt~ipG4m eiPj!}od`Iq0C.տtGhcρTyZwdҼ&4N== YDeKdO7Я1EQ06uQtC7׹8ھh)bSRq 0b)<^zPQT%N2tS9r[0#X77ggqw뚳|>/ws3E{u(] 3]ّcssjD2Q](lV͙glGE 9&# SÈc9N ^ }*|!+pSΚv"C!$(Q-.`͓gx(&hVG r|)8'+9EN8WoJW"J}|1l$k.z>5c-$SheTl73;G0l-{$: FVcfݫ'?znZ(T2sDt;S[Vj {)_@Y -le%qٰB?Qȧ,PΆ/ lVrv]ѼhOӄoY/wa.r%R/hFf{Mr| ͡P^gw?ח]BxDҢGoE/M*3JL d "|h(7mm}j)<qpE7OW*]긘Tiv/n(q^nQv OÛye&HKQ.I{Ď$A:xbj =Y4gt ' Qtp蠋g:uO1Cʭ ̖}$' ;Iɬȝ|k!ȁUg+|0rsB"fhj׌UR1J)]O4')b61F3wscI P32fڟƾ`hE<04hs Qnݧvx$_*BoZ t)p9 @Ht99^ߙ"M)@ czBe/:Gbv#7^Qe{ϑ3qR ɛh96b%Cn #ZNe6FBWdk|';8ovh7[y:rw/^_UgD0w|RZ! -/f3s}Q8Y}9lDtQȅ b]pn_޺ Կ~2rMwIz+'ٝ3AʧxP3UeHc*:Ķ[t.scPYJmSѠPVsVⷻ{zվqPˮ,j9n`o WZRާJZ p_ڕjg m%^ X /p׷ϼ?rJ4y<""ݬUצo,x"XKJ/4r80EnuG=y!pVor%|3$kzpJ+ɃuOGANg%cܜZ{N۬mjedP#qzI|6WFh/tX ! R h+iBmuރTtFeM#Ŋ%G};*4 { ʟ _t/N4d,QNCʉdqG+ /eN9 gdtBlkNPʅJVSw;{d)1="ql=4s>NNbPY1 ѠMȟNqt|o_}Gˠ)AԶjא"knдUdCOǗ//_m޽܆;g\x 14 J-ۇRAzO5dȭa,jxQ^ 2+̀t8QrM$ ;Tj~Ʃ"%ly]w Ѱ<Au;ft/󫫋sv&gi%i Ԕ.w*c8Z$J H+o'݌E5bމyeuFs0\FVz%|{6vu.>]acpev3co1;>Mt(޴Pb X؇шN!s)TM.sUY÷U}^^Ze RH)66Ehy' dy¿Q> fhg{s-]0%1 z/gq0iڙ7MIͭBowJ2ZI`D>$~ }clZ#4m)-@ӲZ6A4AuVMvQӗ^|0B^T"Rr < 2ֶ#䞊Inhs?)M&Ev||Oƈwv].?O7ROr9yrgkZm}Zfz',~>GB6ca8 9)ӟ|47\ZMfmw.'Q c&  zdBIVEzSiXE?ĺHr'+ynEکtj xB1^h+韾z֞ r!/PJ7e 4 qÌRIz?U[Uz 㚚yN텄7ݟ~p} oUo񦷾bOלb@NJT\VZMմ/0]3áވC3p%viNQ܅KsHl\bíl6ۿ͖pM]xh$7p{9bnBl(F3 .~К Oܿ6sLҨx_ *BgњK*%.^䪦BR $ڸ`Qbv^TƠ{2@-4}JyQ~|oqc`^¾P e-_S9G\e!fCrE:So==+g/)/hbPibqPzha>:q)&{pޙe!孓G;nx̩X8Q( p.r:>j;7.7:003y䘞5JXض`Q1b# C/]d;"Vfz 2 QRmf qsYq;_^{{zކdR 8օ,v=?7M \b(n~KР&\tAikA3ɳGSdU>Bg;}}y5wNGuDRu@.۵*k6wXe8d\YGrysT[[{iDzN=yܲ0x(0Թ9Vy5\LfkqS!ˍ}݇s\MMФf*x5jx+m$Dbջ-fuZ+QQ_ 8yw}7f5Yx5?/v)z! ^!R^3GRmg`8b8P86]FJ# YZג>7%6Lh$CkZx[1MJ{d3[]#/{Gzג24 / ,RLTcQ)^`&V(8u*U~89 ''KoTcMR߉Wœ/*{>\p@`U^(~huPQ*i8ꯪmDBPh牻'l!Q$jb(N|$1\tQĉ_ XK?ܲ\* EvZ?8<^C Me4"N`T%vEi4}i&I&B~f:Jrtz"( !{bJB mVmg٦WK7ʫrE,~5nHDcVڈaBS+z}ۇS%ңM %Wa.>ELWb&jo3>QME [Յꋫ}"}=r/TXIU-EF9Va܄"#EUQ]ËJiɤ ?$ZGLe3HK @Qf2|Ž>ݎFq\" vTQźJ%Ѣd4dL|z# ?$Ӵp)Cϧ-e4 }76^oikW ?"6Ͽ~+`M endstream endobj 289 0 obj << /CropBox [ 51 98 561 694 ] /Annots [ 290 0 R 291 0 R 292 0 R ] /Parent 1195 0 R /Contents 293 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS0 1231 0 R /CS1 1230 0 R /CS2 434 0 R /CS3 435 0 R /CS4 436 0 R /Cs6 1230 0 R /Cs17 434 0 R /Cs18 435 0 R /Cs19 436 0 R >> /ExtGState << /GS0 1251 0 R /GS1 295 0 R /GS2 296 0 R /GS3 297 0 R /GS4 298 0 R /GS5 299 0 R /GS6 300 0 R /GS7 1252 0 R /GS8 301 0 R /GS9 302 0 R /GS10 303 0 R /GS11 304 0 R /GS12 305 0 R /GS13 306 0 R >> /Font << /TT0 1246 0 R /T1_0 461 0 R /TT1 459 0 R /TT2 400 0 R /TT3 406 0 R >> /XObject << /Im0 307 0 R /Im1 308 0 R /Im2 309 0 R >> /ProcSet [ /PDF /Text /ImageC /ImageI ] >> /Type /Page >> endobj 290 0 obj << /Rect [ 300.24001 155.03999 310.2 370.2 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.816327) /Type /Annot >> endobj 291 0 obj << /Rect [ 247.02 568.5 255.78 622.8 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.815718) /Type /Annot >> endobj 292 0 obj << /Rect [ 255.78 403.08 265.25999 454.02 ] /Subtype /Link /Border [ 0 0 0 ] /Dest (G6.815718) /Type /Annot >> endobj 293 0 obj << /Filter /FlateDecode /Length 294 0 R >> stream HWms_TDA8werY|o:4EHﳻHKӎ"w < n36jv߶s=lfןN6o >Μ(\^JQes_C?{}]-j0[yQF-;U&o*B䦎(,|;ͅlEj!1}l[+w?%U&nޅo(IxB,BeX& ᴟǿԪMk'}|^7q*} MßI9W ^7C:.tk݊];wSM57@fZ4 NRU\R\ /Ӧ]5msYggݰAD~`q})*/͠$͎##ֈErs2i+Ũ#([މcDA϶zWA߫wD&!AݟS{gKZA>kCÓs />POtuII?;np x8q2k©݀iD _Q'CZuB.lx!x޴:S($SOBS/R~ ˿6I+@32ZNo,?zg 4 %9 x-+[WOOb_*czeߟq?nE'ET~/n.z:RO.![Hҽ*Fh-=RnOR׸ uU絭.%M)U7K WCMhG'ƎW".ٴvq#@ H G[JTU6GFޖ, ŀMWDXQ,#l(`  xiXT1RVkcG9wAG#ԈsKDh6?D褶)\#g] ]Sv03ҽp=H.LZ(k甏JϺ xiJ|ZP[tJ} u+If?D :~=1i+Pe$ŽfH w(8/#/A  " 8/~3?icm)b~Ą]|?qqRqkNG1{\=NO:RM Fv@FVeĢS jiK4}Ҽ~D\7R|Qp^aΏ*5}QGM8"s )Gô7X#_UBM^VR//ˋ,؅xObMw`8a)!Zo"`( :<ՠ95 b%y=<˭fems_։Fr܃i fE*aG"20=NATh@DQ'1B/=^X%{hqDebuI&%J }FzzL d zGhgb]|#n4MRé?ۂKuTbzqGw; m1LץDyӄL(qzyeyAMs-4ɒnp1A\[iz-k@" G61JdO%UC&Ѥ=OiEkjF]=-DZ9H `)dM;a,~a /nӍWR玡ApFTg)Dw̱N:hdD;-n)ms.8e0iW4nn"D]څ7 W8S٨$c rb8(Ľ0d,_Ʉ4X0~|,N_.F\8T5]/@I\R)B5P%;V=;X A )uΫe7wi Ѹߏe m D"҂hDFO=C% @><cdO093S74-e.>꫻D#xmpKW8ޠz({>>V/w%Qkv/cs`M[pܙ/:0"B; z06F6]&1oW˙</w%7CPu82.x]]4kgksq]םjQu P vwAhg bd9[cʡ]UrL(JEK:lwҢb W.%))!8ߤ@ &(* ((0P5p$qB`;!x(C0S2H0ia113`ul9{"-!z:aOqD)*{Xq.{9{pj;;ā;r*/ݼs]%q>-Ip$Z_]$*?VdK;Rk.A|)D). &&kS>'Fk\(ͲKoEgy$p4&]*T'$\|$qLV__,aGee|u_oOw d ʊ|S-^ xooO_8=<@lFsH:h^O>C%%`p)!^?^m^uHfUوg#5[np`i $e tY#?E ä]Ù}.z:܀nMpf3%j=3y[5g;/+{xodž)\7x]*Kތ6l1F;Cz=u.ńT0|fuy=479PE. K Ј{[Wv&) `Iqq{8z(9 ©yhij`/e1f)s.:(9>y 0d=G[‚8'*v2O|s i"Et-.D8][nqRe&}rJnNZ ak=I!zIwVyS)uﲖsOYT|E2w80.1z^b8JH!mFu>SlGZ֐)=F!X [r,Z] s!勜CfbS\νfpZ״EmqmTVyJ͇Gl9wArmP5͉B}T eaک==ؔ+Ux&VnB8k f SkҠ్{ 6X9gYI22kF jjk7 01V05+ض1[?q0^6'SQeS*12] )G,!#@0$5nf<*1 ԤoYvbq\}lR!6ېd| f8tyxH3f :Ԁn<_~<͕,ϬY%*4 D `G' n L| )<4IYN \ux*<%֫n\+®ꅛWt%{}=z IV%5$@fJE di(4x+ĹkR jdܦ m 0ۿaWujkhNX&^P,XgY&d*F2+Fbp'2id"O4% i~K$R2ϡLs2&h\FP,`]t|Q/ pfxȇ|zh̝+ˣ6>m Gp^fHp˃53]%ɑ0> ڥ|OEIpS{nTI$B+udħ}N_nl]_Y:%8I[ M[9Ϻ{b,.pIf de sg-e$< Qx3|fNx쌌ӾGT{2v$;H_(C poL%xkбJBH\&y"ҬJtF!#<˹\kNт5ySW"%9uv3=t߾}v' ]9q ֳ:DZrŁ둬CЬAzc(a˼vD)V#eGLS"׏dsu;;n*T>#˄1ckjRt.^)ڵn>쬰Ij䈃:bMOګcKVkFSDNԄiTV\73dg<4t) ܴ>SdEmdI ߂!k.]܌$xf?PL93N!*6ӻk:=fN{:iLֹD|dڦ|jd}MI+V˹q ' H ݡY7ZB> endobj 296 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 297 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 298 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 299 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 300 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 301 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 302 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 303 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 304 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 305 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 306 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 307 0 obj << /Subtype /Image /Length 24396 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 434 0 R /Width 425 /Height 188 /Type /XObject >> stream HW_XyiiCЖg-A[X(3#HfQ#aFRuٿto{g>{ Umo aMVOӪV + vƊ+XP \Yt3 M_Caj"t 76&I`JPigP)?RՒ:Xa !M%K"O0h=lZXZƲLXXxѬ҄OE>KuI2TvyH~giʙ5Ⲭ.]WrVЊPԴfDBEE3:[^L |u1N|DcCwB냄|2t XN p >16;.FCou=p_C#0OA <_KX3XgZDrkj՝ md9+D\_ݽ~@GSO]3+KȽP[k}}m߆+AWxmn@wƀC0\g]S݊V\AY08rp}ɪ kBx2L"]T}]3Ml6s]Ia AKRԃ@u(]1CxWezssՀk`}ժ`^@L _f5pF W/XR=1 ܿ;JG'GkL}zoaGȭG+\Vn?@3_Cq21=vc9I}\89&\gM{7<2i9F~Kvl!@8."T-6ҿZﷶ_'qKlLMtZ(w?rt޾ٙl6ӫI_|cc# $ )|PI3Ev&M#E,F;uAt ֦/|ٺ@17)2~_b DOo[ܷ;‹QF$88N8^9DFA<`x q@E2'r 󒳂P<˂qW iT&JxrBڋщ.ZOyR(O&J 7INYa:Z --7CYps|5" Z& ^$^Q(&J&(j9ԫQ+NP"Ic(޺Xjb*TEx[(H:!gH 6ɋ" ͉ܣEY7c's`n^29y@B))vtn(yr"P02)uPQ,N- E-'jJQ`ڄ%[ZʪusZQP*Ъ%G&gi0)*xORW@8G> ".=kZ `ڮ_z]Tx>CJ]>3J3{䯧$8<>nb'GgRVUaXa &AߏY/x&}9?2Yw03ɥ~iUד z |ܝfڼp7i юJw=beig>۶Y֞Fyxh׬uTuյ,ZMrYc<6g7Er;O|N8^yn\$NztPͤ2%q ~^v%~o[v}]sz&R\݄MҎ w;=ء$?(#* K!͎Ѻ! $~>LJ 9?u0qE e=9k &Ee}F;NW9Ͳ, <xR`q>gx<)ң@fP¤1Φ+Tl R[3vkgҴCDjUU}V-qD?YɳŪsح6':dI]RD>S OC Aj1Qa5noݜ f TDB!.L!`VT 1h$t[^RUah HKFZE$j{lR퉟Kd@q\#dt)ڢX߲G$A5{f`L&9 ՊF:S<W~0lETj .L+:Got D|ZpT҉n(WMjyeydWB 9/_IfAp F*{ Y٩,`9W)8P}8\ e0+I O6"d[n&䃌sT.xt/ :)eKWd>2XIKc |Kf*1^h_;h7#"vYepr޻da2RMMW6opw1#k\sVB9*?tRr= x'#z\UU1M']d=2ҩ*2$תxh,R=msCoz SV޾ l aW1wb¹rK9h;Ʉ{5.̳}k5as`b`&Vn je>Ͱ`ۛ%.L?}]0FM<<n g7#+6_D>5\1f3 CS@SD#OaCEq07 VK.UZ.YC iuB7e GreFpZ̬opոU#pG9-se np <ӟ?YG]r{8׾=]o.T"4r/xgX?VVkx͍cӖ ǰ7{ru'?yv۾懇;;}x'[nm7_}Gw,<,A$\2x..$ZǑܨr%?dS\a8;4*rYbqF?&mͲu}_]} {E QQat郥}.;z_WWB]̊XP|.`BAEHS6"@ HpJL ሂ"Jh"{gR&{rߗL2y6֟ȴSf![ͪ=b`%sxlm^6|&~ӜPm⪭^ kvm[camke_kmvc66c5[/x{G+^M7[tڴ|X,p5䀍:5̔:,VEL<&sl1ѫxdp4L3%V牲@ Dlw"C^'Q4u1`K02FyNoٕTͨH` )Pބf #LGNUTaXLЭ0#<d|,--J*)Hg(dBUciT[ee%Y(U|ϒQV \Kfja%Ŋ)h7K۸^\DF5 d95 5Ѿa/pz #H3J@' Y9YY\.Y:pi5rXWrbs} AШ$20Bч#Q?I'C'c e:?e|OIPSi`9Ÿܠy@+Ve . [pc ZYpƻU%S^?o.aDŭ2r^,F:-%qlJU@6+#k2;yU_,aOOmYD>S RP8I53ߙ|x-iNAu_ KJn~.쌬[l;m-Feu`YmwX'z^S!R)Wk$5js~B$N?96ݵ\3#qɋ+ wK"Z4xK?"Kb4"\HLLKJ: %/><><*--*㑑]GCH3p/6 Zm~fzzo/ 2 LRЄ(?Qk {{vImBlgg=-=Z4MKoo_wǏ^ ~7##mZvttll|bbrbr-;8$2L 101Z@͛WPp z{{g[4-f;:gg?7vuw<5懿F?jA%< {-1hܵ'=lojomѴӽsA9 a౯wմš?b^S@,bx%X1"oEQZz4MMMf(N3zvkxML@mo@' QLظZb30t0/h˗)/PgCop IӣR4>aSX/ q lNN5=8$&1._ʃ{1qG݁0ʹ4Є||k;BC3  Ԣx vz*;884!'(z n4k:-OoG^G_/^v[6m{۵iǬ_nae=>65fػZԫѩ&Z:xWqciŷS *աZ-#Ю"nt:j놡$@. yׯ,ɚeZzO/%w]08C= "lB)`u"u} _>$n2+ zC?$fX QOʤ7jM9xkb akxӱ1UJu%$ [w7a] * R9Eo4O L&53 #fZ-%THTuik Mۮ=UWn>T|z킫~ㅭW&:Єu[w.m[[;'';a\~] [N 2:aN_F߂>J(pVZe8UJfUr3l KBBE]e,0@ d9,HĪԕټB{z)9RU^nZ2JKFB$pD>h&s8A,4QPa^D#Aԩ5A)TrKO*Bƭ ⥳_Y|sKןrx(۟dEřB[$;hŋWj{?4/\Wnܼ59@8ipx*d!!pKfـ['YcLE(]<$w(URW]A/"nD^vqoeBS%25L BSi,a 7'!9"lܪG,^ ߰J_bj޹SUᇞE+Y]BƵI]ϗ(3,[~Yug+n5VXs;F}vv ּɱ[}o,3(^1 XBo1ɪnK JumdT"&v(//lzȉMĵ{</ه.jG qRUeAH\={0z:iۃHdxx+2t:J6 N ABnT}^<:M@ ;0lwj`u%30ˍ+r=cc.Fta~EBY!.VwF}NW[:X/Bp"L4Dz0Ͱ"0 M}b+΁ Nɟ;vsI_*F# Xl80llQy|6A#1و'ʏ(/eB*=IhgvՃi^)H\uN>_8m1{uIg[N E(v ԏE~8e݋l[Mo,`эX/*+ QSPTx7S<]e~5cc_SWF53>yk,?EsO>zind͒'֫OWű<u5>O:?*qITETfΜ9t"m8~ԩs5{6xxueu7ml?QHաc{4R*AWi7C0M"ܒ;Y}?$4xwEX5ni~ 5H9Rujl,hQðP$X F'$IFטD1f<4R A)GOO޳GZm'\w\22֭;XVT*dߠ YRI ISe3 jZ4J8)It{CVͽ#r+(NtWחK'; nv=0ϞU߼ϋ'(uL%/t5~6t~kdc0tv}Bʃ'G#?'˳C:M 1EA5ܾYn8fרEEn,\wNzXB3P *&x?u2? #Ookl쫋7\oo[ m=^b/ 5/oKmX/Sn5?[=)j^Q((RyTzi K*=GK+ fo?#ko']-ywxC_ #wk:'_I :CyOUQ(VYH%-bTVa1s.]/,++כ2tZ;zh^RЩCCSӓL` '&~F7 /^ ?~~ ->#]WS=ѡ!$ՎA*x}𨋇<uyEl*X89t+s5+%<,ҜĉHYV%Q@zL5Vfgbt cBLCSCx %hNNMxSffɤ7 aP*'h)7~ rw2 '(pWSq/w٘ﻋ R,*Ņ9eu["/R;(w SG{==!L55$)|x1X\FA{AXNI^Е&.Nia%)|C-(upQ(MK})R) MjehtY=f:.rOz=~Z jI` L5V+:X(hBL-9L(e ; *YE-[bEޣ-nI⠤{e͉qq$FH9ȶϲ*Y᮹ f?̢eLMp0Z͆D-\i .@bӀP%N~䄮Dd^qOKD,w9n\Y*Hi4J1;TC-Թ fOt(PPXr=y6/{ly;<`?[Cg+t]4U9eR2C^$b2R<\PTX z{BJI "ݟez۸(\(*&3CRR’c$GfMl:0R2 E"Z#[[P/}cck"p)^gZ{\ȁ aD#cbhLOѻ_w7gw?CwuA@4m!bJXXTB g %8T"++9bRMԩkQXmE ̂RxrPQfI<'PW EVEZ[K/9~潕{oܺv~ZꓴmHi"K,Uة1΄B#k6 )J:>uCs.YງWK,^= EV.6~8ל&0? #C 8+/Rm8 zq?M(΂6ϋxn/x F"ۃQ3k[E +5Yv[זƍo\orO__T Ua%}6W~YSP}NE~ߡ4'^VaY&\ǻU< -=sJ}}P^Hdr;͇?{w?z/nv'iFno 뉒8=OLPҟX9Iw {)M(1-> `J|5&*/X*RZ*!=v=γoᴷK'HXѷt-2^Wġol䖡W yΕXz̞j}?PQaxRVV>Zzfwv&ǭnV(r18K}^~uuCZuĸ4UQ%ђ5$~`{qqFdgi(|*~ fpl5;ڂ*S޵ihGyso>i׎OƸFaDQ*;ULaBjx5=/]LrDsM4!"ĄNYF P(')UxQ$Uj| jL&S暌cf3-"VN"N EaNH!('T9]`$TMbsdVIK R{CQ?V&-aP+:[jX A <1vaTh>7LFQQj:OŰ &^sGtzeۄHIy%D)ꆰ:ty)cO+0B źpn#*|u;j~d@lut0 ." JPRѨ^R6upX(PsO8qBPlףZlY E'vMцBlKWZZzti/GKczڮ8l0e0@1qP^ :NHD~!TMiEƽhx| wúC׼n[Q[(d[ I,p WTq)<퍱)ԓj*AkH6l4k) P|]rqx^=(NTTЛ/Ze@x>%e޷5\IѲf$8&(i6TչVN):OIWEQR o\JbӔz&.fP{47=*";QI@C7/o/wN!SH:b%Is<+%RPtmF`{GloI[=I+1Q=h4κS>lk$MAQH.{[%HQ$3$J7Eu5B SqZDNxsnf/Z;\x^]`\RMuuMFLΊRVQRv+Xe#@ ܸ9 {9)=޲jU酊NCe7FAPmCCXeh ~ A9"a& />ʶ>L 1bg;q>[3IAF"TS`DÔ2etDPTI4UET' +*[C)]n (JۄCj}9vVaVIW ljd?]4:},zBb]v&\"V4!+>AU"R3۷siF=ALj.̂:ժ( ɨc+"w*2].1ln8>}[@.aŰ`Z')^QLD <#~BPNW-@͆tAU6nx'VT;=kcQzV%aHA\GdA G*OhrsUT= ߉l-M&֫<=X_]Y,7kKj:E;S@2T1">}:p[ ceEZEyLU"dM0P`v W2@}QE y[Ҧ9[I?Ia9|~ox6Ӣ)Z"E**u H7K8<46Aʋ|+PGeC"X#>v8!751 FQ&%0ō"w<|:kl lbNޢ:^5&g@kl<7j*,B8X8oZx+^8R~yu!lbbhj'/o6XO`9qDŒS"Oж?n!P3'ЗL&\tㅱuˠu|)B63kont7-Si1'+ƣp8X\D#l+)j}ٝr-t oGf jUx9^K޼2m!Th`TEmp S+xxs|P@5B$Luji:;u62Nx,?b' $ѧo*l2q%?`Xl5|OˈɕJ{ENqaa x0U΅l&7blDF41GS8ʩq .K.|u:W=-VrZ=Z` HTȉST *UGhiJ,dy՟ +Ummkte{坷j@9gN 4ԣf ]  >sU&* $4ie;pfA}(*v)IRBONFX0f $+666]M̱;MVZƅ^hAa2 H8I&ljdu 5YXCSQye:%+TX7QG&tBGgLn(igh?4CQ6=t)J cL{fDaeOԁ䔤ؠc Tzĉ<W: :+X[I(/#.};t+@:oHSĉ(jχLQEL\]ɜ.\{<.CUY,,vBLfH;KN֓(zҜLݤ 'ymP/ժr̀m,}zƲk$Oƕ rzbAXTtcCZƲe?oF;]P*=(x_? x?Lyͦs4CM/NL3b5huFΕ H/##|>ۑ?/P+Um6ʉUQK^ ]68M\?LzģO4hiG51luRJž+hMXd:T9tɔŤ̘FbǠžڝ^ ) (ps[hpf"AeJZv4W.* _5Ltq[ p@>{+*_q *R 9 J8Œ0v:-"&)aS/9([ww/>ӃgQ6[ OY7۪wDx011AKsD;3s;$5S"(LոzT]|>KOi3o%䬅Lzs>ܼxx"!9^DsgevaPD{]W7 HЛ *Ez<4͇6ͳMwx`hWM=N-JJ:jQ0ԷT9݁7S]+&]]]jojbA1%^z~ݍ/ɗ_|J)ˊýoM=BBSTOO8s;BSzU] tCיHQI'RèFQQbӐ4 _06жIP7677~/=نӣ:=*%%u9Zfu'EdP`LПhz:I]RKa湑;<Ŭ b)QcJv$WpJ}˗q.|wϨJpp (ūNqjmiy D ꉦ d}3HR Լ|nGsY@ċYbbH$$jLf >GTO#Wa!Ԓ&=5'(aR9qŒҤOxX(>0=KDu{i0ѧ 0aK②aLʹTrxco&)3`ޣt'I{pEU^Y c`|j`O (2Lxhl=$v&ͣR;i"L(%VU  $y1I6Bōb֠nb-c")ԩ6 &P (p>RsEY <ciBed(?B!w8@at)%Y>T&ynǍ| Jzg0æ%AIorƃ RS$7RF\u*JSֲ̆;~7ܐGh jX&NBqD焮C茖!%/B/bZqPn-&.#9 %ͦ."v ,0*R*4Q|f[,I;6FGYM('BYR{vFM)jR£)EndC!؅fuPM0ٴJgx PUҁdhK%)hR`1ΰ*+C\|ԔL7աpB;AJ'S"]MJ O19 )$x^c(<EzvNeSHfI wNmL**UJS8L(M9Z2Ҵ4z` 1=/TG)BRXSwܐ.SɸBitH/L兜̝܃n(眪A]F9BBaW;hEJ50F [#̌E cqؘ3 [`8aojc=@Q$rUMt]O "_qijnD_\HDGV&ZMXfX)qL r/-לPѰѰu<!S-^͞NU TC)SݘL rB_J:ۓs(+<:iusRЊ$UJu*%LԸ6H29cb1%%'Z@PZR8g)Ez!an9CkqSK/`-)I>䄐L-,Ph{go^zQkٳ-rw~uU۟sUUUoL(d_\FѢ| W^UEC\I 灨|/KuԠ&P|oM!1U,vc5@5P84tS'N?-x9ځ59 /XkhHD-q=4i_diLnҜ$o4ۧf0Lt \}P+-aW45tuA\U7 |tH.\ S GvLȇkkڊٻrkE|eaEZVu|WQ8ٚ߮VwEO~#n.G 9OF?y]wS}uŮof_7`yᘿ6yne}Gnq0wkvRs ]!u q9|lE}dS]3JH~rߞϬN1|gy(|YUE lPEPB1d%lB#UP,_Ul)l<Hvf.乿3cx<6mž>sLBx|?в%dws11%fbUlF9n0GƲK60 MO1Q-Ruضp!t: ɰهY0؛T!J D/Ja\Q`RDEnyhM:!~$h'554l0jF>LeLlP!/IDM +khNby.Z%G*HtD^?rvMp# Zl @k(4+>il  Wtm `| 4V-OKH X: K J d&Wa[(IKS;Fٛ'GGo秶 [8s6N̞ OnWm#oL/[_̾BspO7.3FBFˬQ`ۯ0)AAd,]d&*G-?0ո%o'jK(Gc7GG?N:qgkgi]绝كg&K?,]7[B-R맻㝩{#U5e~Yz~c]q/.>4*17<}?lqz78g`F |Y;/Fv/O_,ǧ:gpLOɵf'=W.T5JC}Zgroun\o #GV[{^&Quc+.pt%^ò\w#gƑ\lDhm}o=s.9cJ䜣<.yC&>mr͵r6&nc>> stream HW[XGi4I-+-HEG X:VLѢ(:ޤIg~}yi==ܛ&m ]gWAFPmD?Tsj؍$MT̥&ASDlU_@ Lꭴ.F2԰&zMղ|h [6Ćq&eHAfkAxFhBԆY2Z9k~͙4#/DW0m04b" 0@*88pa`MQ).u\ʂI q\BTrAT91ԇQ ׎z]s~;?EIl6LAI* V ST&B8 TPâ|p"!Bn )*|ՐlS)VVGVQB%mYV]+$i腐5”sSRcҾ ZBn?!H)/괚13NV(3fH ;{.r~809'<@rz&ya4f BSf(I89L&Bs*Ova 鄤Pl&N2jA8^pD=^YDs*BOw^/3 ]p.O\뙽>GkxOmW񛝳^n5s/[k7-q-0z~_w- 0>wwnnjᅨ\9v&zcAÎ)S58$ɔ}2 8P6;XSgW.t]խwDvc6pfW3WsjBGG?8I~!R_JQBҔu:7S&z8G22wYklhCgYì}[~CZawwȈ1`umqvqĨqgL؉Q/]8IZ–CC>8hs߱o=1\xkv$լv]8/n.5c-5]ĴIf,Oc.[м{xȓ-&3 ehf a 3ea:Â%Y0ЙL*k@ `1LuB* 4쏃x FeZ"[l6T IVI:)VUQMinh֮l-ܨ#Xw8 #fM#s90Cl>7ze!.- #QL^#2Y-/'Z y0ՀZRM ՐR!%C'UPjM%=#sWޤF 3Js>`eR]\Q:Ӂ#ςI5ekPӳbSx"JMpn_7D1d5O_VO l)6 [Ed"Ryk(ʹ@Q#}y.nIOh&+4Ļ$p0Na,X%HU4`8"cSeJTM$S*]T?MIՒb_ZUMLɡ10袲 BŭkLulݾ8(:gXt~&i(M=Ot?+k%&u*אYXJ+Jr8}#^2/%YXu$kEuG%Vcߓ\<^}eNgLM;FŚ>7"U|X|/K?G(r'\WW NLXMI$$Vh"%{厔DRGr}O^ϕbyY/KɘbYfe5Wp uUK[ڑ* [|3ΥkWлwO?4xXM^T|pp+7R8~"z;dL .R9x^}Qem[f}jfS^ͤWsWω*(=:*>&"=C ;{\.qS/뷼vV:L0|zEowP=S8>6X6떗G}t[R0  ?Dִ1äTìf?̟?5sh܇f |ܙ|v} 3gL?t|E}>;_x0`FuݨnǼbXaΌӱVRR{GMo>/[?7''i"Uc&:=̕XRNMg9['Suza1*|d ?3^q?8-/,g>3FIKD7dLapH2/8Pp[Ó/%(AP%8eJȡDzm|8=Q,ۜzp1kqF͒v6rIr-JRbm0QJgc  oju[f_[Ny}Yء r4IReU27^ 1ͩ*uVb ܹ\˟0NTSb/aCKP+hAQrj|.Rx](<`mydL`/((0E`^=& am1kg0>JJL ÈMDRJ b[z`L|ԋ.>%zr C ީ!OX\L\H/a )B.eH,@dB5< '%?HˉpɇR0ee܀bpeI)l6::/? W0>&Li.$)[5DDlZO-fDb>POUʂFSQLM ]^^fŒűIt\DD` Om(]G^X(@냴Sx#JV~=y^΂%z[K UO!+qog#$GW ǁ $q3ɕ@K~ h!-!q$8D4Z6pʐtFZ )]\D޺zX\iF>]@!'X(8oQoB@OR7,D&[*jd![bLie4ɴH$Ft2K$h",rwBſV@~ܟ_ܙ>Oծٹ0oax&q@Rt"*1dJ&w E 2&- .i̓ 9"t' iETPdöbż{6Ĭ_,SaJ̷gc1 'a"Y+sat.4U8ph7UV@CfyT7Z-~\%hĸxJIqLxD+Aj4GH9AG1Vb4`択nw7:U-|H3宔e'vaI??ܼd;1+'rVu動'_gsJjG]#o ~1Ug;jFKxR);׹?pK9KAgRAQ:wO!`З:ꌦ֎^Y?ilݼTqT|W[Ͼxt W]InhQ\Fe*b9 OA"'@.ԕU4PbH1R`+굢Alsl}Hw2ƑE׶qDŽÊCLvoL?\tkL'}/:v?3"}ڊ΂c۶Lnv;[uۓV@"6WMEZWR]=sKUs[[ z~]Zc=Rٺ͏;1<-`)'ײַ?E! ) J2(L]Nlgbe\JTIub()x\C0,JG[sh+2qdkc=`j*0X|09`** 3,. !G&v9dSb=3ʀF_2`t"Wړfޠ_Ì**% ~(B0J&RL\I,#m)#I, woVLM8l"G٫'S)41'1y&5[\?n ey2Ji0}`QGLayd<]9J:uS#&0O|'( ;XXۏR'Kݕv;< Fi IyF*>czQ;䭰+Nbbq/[ &ӅI4D gOg `PL2ObեLL``SYt!Le6LK``aylNhQ䱻lTj3\j@S7%O]a^B8e T6 _gmz"Yuq.y sOZooNBenb"Ec٤PRpwuSQD/(^%|݀0) MBZ/0/KxIFثLT-.N ')H{?KR-)d%QayH(,ͥ~<Ԫ12]kLW{Lpop*"!A(7W_.;8/\,gGE&kvc_+ }E9i(7ϓHD"X"I។&+ZM;3LDq$S6yP?*b-# |gx FҢ)y[ og13},*5+"֭׽bcKKjmnkk{ \pO\--L:.?2^Sc^m$RebbxxxBB)))pMM'9sկ`H):^}˥37Em8r%p?~3H#g|~yu!J@H)B8T;H5d,u Je7Aӿ;=L+G;v;;A8BoϧCVw©Putu76{?08084<<2::h4)`Ow4 @^&Ǹ׌꣣#Llol랹oۛ*::U2?uGeewsscc[D;]pۋU/_oM O,mkm0-o{:_vaqU@j(O{3Ўpn+хSB(QY(  ;l,lm~uxi7*wVFWWVikkase}gf PCChrxj??4ccPZh@O$8 &Ap9Efg{{Xz37iFD脪v.jͣe3Bg]bsc;Dֶ\R&%?Ǘ&x Lb/Aaj,,@nuIeX\j?\Z8YWم^%(l?nu& f6m MO N  jG'4I BC@ cI!A"y@9DMM R=]]LP-u'F T|KKK x!K,M.Hbz1etixȯ,^pA `Hť@*YUvY\uk]@ԘáY䀐 BL8)sq}\t3TINe~ZʘSŽx"V1e:b 'iHPj9\$@l4}iJ,W Xu"WEF#d}5r5>T.mTZJDW9j9x'\~S(lcD}a}\+yd{al˘"eE])ɚnT4mX6SC0?eDτ@HB4|jhw`TѶi$vV6-ŸAG'd\}6ⶹuݨNf(S$ͷ〟ihB%7"7EGxG𞗹DvLUU^;[Uf'G?O,'}࣏nד:1:Ҏ'UO]\\ܳ~{OrD+a/2v!}#YۂD-q!aWgY뻃$zP4L13aCz ;Co.e 6-Z[ڧ ZaϪ}Q7be+'~;ɵo>J̙xgGmXhE0)~@ޔ^kfu`@l~R9:RTv'5Fy{/_$x߭zCЖgF'Aq |ru ,PGЩŎU0` شm&#22IB`~Zu__n:8! Uwf^|qq~ŝ]PdiH ˫W{ c :b*Ky(趰@zW͛N].#VNE"\Xw=X-E;>sJ|sTt/Kڮn(]n,mJ^~( Ao0*g2`qMIvb2I: m?cGKR1T Z$a:*TdmȑUq|?tqj%Lv!eYS{crpX)):W &0NQOhP ۠@; "- enSrB'5n~>A#.mmkuυ㣃rtcߔܤI:TvKvfNsƪLtIkssfXsJ-1) l`?j 7ɂl mԉ( JBS)MlXA"%Q*ly" +ܑ*gS|¡*NiSr FN֨0IYj&cz2O3S'N$4Ѽ@^^ '$Kۅu EMyV{:{Ԡ7U/^~##0l3lx`2LY%6_JdslD&2/ԉDΌWL =v;c&N%kcNGy g$B8 4W bKl|y'8FU~|l)n: h6'{A']Գ@Z3{{;;_2m9 ,kaz966:: 0aeQ)j`}Go e)qq aSֲmY-[R-DQa!Z?eh4``PaYFK# N8QX9,a$* onb҅zPCʺ^vd7f< J ?d !5jih5Є2XXjؖOI0us` Ip잲,t9DN,N9J[O jRu8>>77냨ϏYD\̹9z31QRҠCdZ~ (1[~$ ݬrz%{Qo][?MFQԍ[P@DD%|iu\ǿ/&,8bp BV Qtf "!@EaP!ɐZwvugU,k.VYVADk?Ś眷t R< IMy󼟝8i |hRz;旙Qyt ` $3vX=zu-] O._z!@OÞar 6SOV>>}ZjKޞbMɎK{Կac_Ki) s5^]Z ?A0m4s>vh`0mDhrppbyÕ';;G<:!$NO.ƗBcթLu]_hn?ߗ>_jo{Ϟ=94&t~iѣ $_LN ?} yf}ffM_ͽ[x9??77?[^مY9C^_zib:-tU߼ jU Ԯ{rm']Ŋ!NF>Ծ} P1"mZboO!`;RjokE{Ѣ «Ql}p 8?Ctu_8?`}g4[mbPNNNqV4d46 `0d(Z+ynd8v:vgH^<O 2zi4TzNJKMMM%'%ХRZ3*e<\Kι\~8/"*Z*𾒌d{痭J_ 0rO \*;,H(JIL)iz̀ fOry]^ȅ\P~?xz?CU0ymN9P!OPLJMbB\p%p!i:*!^<''`y-xFW5 V~&<(Z@LD/CVG }.XiAȝX؇5uJZQ%\YޙyVZB| s{J.J X tĥSZ&4i4k({T=0X L٫|[ eұa?۠}h)R'Iڄ63;uCo'?Ɋ#q_ bm22ۄ)gً`cbSi \N/ ¼xBa3 ORIQ"L ԆdC/JC۳)Pw3{k*YNnHKwF$Ihƃ Z~@E4&Ekqj)&+,j?/vToGݲ6'%%J(R(#<@ Cc%Z hvENy}^;gcF7:y9 ހR7͔̈́!{*VkSsj\)=@ɑRZ-jeOkqlUJpA5Q@jZd>s8a\/bűU[q<_vNQeL{ 3㪋$7{*ָvooE>,}v%ٝ$+J>`Pk~G}X&TΝ98 3x!f+(QVGA-U>ۈbdZ#C+#+l`Xe6J[륵UbZi*^~pw70 -nMS}Ӷ=EGN64t,m=R.~u-Y+T,%@T*YfA=@5p+aUShYa~۸(^,sE2s6ZLyHJ ı h&pں,S4IQP?$:@_R?owEdqss&Ժd}S*TܑcOƽ 0p#0OaxOrW?Go|__90;7OzYѥ$$kx10T*,Vv7$oG<ɿ܋zK`l0'+?DU[1, 4FLf-\p黿r~owy- ۞pS!6qhmDFPMڪ8jp A;lӀ"PCbP`WK͖Vɉo572DYsy#FDl6Mj >_WXԌuŕK3Μ}t++G_qamH'jN%LCV%pAU#Uzs4:򡩘Ly ̨ޓvtDzff,lEǕN7<Aڶ&@Kae掣Gf玟^hAi-?,<(t8JJOƔRTMR9fsS5ͮgzctU(Qť7~dv2@`хۗO_|/>Z:w/߾l,  cu`=SgobYDW>yBB 8x6Eq"~)n]6E0 IY27p~qm孟{_wޭwTe U$FGIƔZ'''-p0ІI+d7?o_>mSϊ-DJboGo|t޻{q5fdl4bweB[kHi1d+.+RCzoGp9*)}$ŅEZp3ssI0PQR!ӖLQГ[8)|V:RS'zs֐(ќp4}=#kvZ>?9sCF (0 Z)2t\jF(4j6Z[&` LAW3 4t$a` JG\Vd#R= -#vv77_Ψb+0R{T%x>a8B%8蟢/2WCDH )#T"DjHy˱}]'=t<.PI .H*aݮ9(O!>? =8w XFm5݀ÄE?à@QA֜,50'8Z^-%c<֓\ؽꊅ\YYx9)-Ԭŵ!#HlUQCrB˃Pѡ)x*1&6=lPfԉ.I@~kul9I@r΅3H"`YbT(R~ RScTaNMJdaĜ#,w/]/^9"&x%7y(UOAmVCt5nG60: Ne#]MmnmŰR0DebR? V$+`WBAX)EmЊ4%6=x MdU*1f1ʸ2"P5 D\F^I0 %dSw7(4$cۊKj@:EϭGN$^”fpT͡xF9$(= .Jhx&$!RGDUJ#:#-V'!q@5t(=BؿZ@S}f(|⸭SK xx`*/҆R`Y~T<1#뫈 e}4 l_PħT⺶J_N );9^H?'ci[ ;]T؀rG+́w9zUK_HؾdEP$()_3XeiH5Vy9u^H[de"e)amb#Fć#DΤIO%r2niK~xr< +BXܸրpgPqkJՃ&Yk:W>%jޔ"_o+d@SD,iO6'-K9(i:ƔFm-Eo_Ds S@mU",dFju6&>Ǿ@H+ʫF-H. RWFi<EY5iJ=?˥7,ݫ&ma6)PdQ#Zvբv'NI` E-PV>ud$䬴ŭ/Yf_ܶ;„@ ݖ&Lm5숲&3i(1qqI'AX*{+%v(rpTVԃV+{ފg(ͦ՜jJ6FGI1}F Fj? hof(EgFZ>zտb-`naԑ^mSkr(?ϏporɒRI~>TX n^H^*p*矾j#> c쩦,ޥC vRKLuv,G1hR#<@"FfclhݏxcNQ^1)sHzey^vW U[Ȑ@jd1ᖕb4CYJӡ~rуJ?m2ǠѪs ؐ7MkF].8Ù HyXcrTTqSM)'R^]8h "&5T@ʈQN~^~/Զj E _Rp~°x`"7Tř%%WEgI9cI=svL'nE/ϩ Hz@%7%$A! &r[PLe|!%Z9j##LZ:?G VTR2ԗ0L/+|Ëa Zpn*Qd}:p y@cDLSZ!d-䥸.5I#b=ll,)]R$fm|Ninb++ X !l&M*n%o%W.K)&h Vuս,̬pe1@듽ržCPڢQA9^oK}t,(PaA핔驓xKeL㺻LU2ui΀ 6X19Ò}@W&MQ&hJOSaHFk[9gvrWJ*(n1p6 erpY*9y4JH0mhlqtGǜl]6)cB 8q! @pD9zPT]{^7,(TwQ0ޗ?<(gӕ55Z Ƞ) .޳0 @\)>w&|dɉ[5q#el&2lRi, 2X=˩R 4.'أHQ-#z[>IFQPw̨PW_eLn+%'dFc#79E1,I)S$' %-fp1):ظJPnNi/R8M("łJQ%JrZZpbqA<0J!R%Vl>WȬmIV'OC|)$u;cY0`| 0.L$A}!59$]kOOXB&~l}LJ(554;a(FP$ ߦd2Յ?xĬIx_]?GJp'\(鈒E`~=-A|I-̏;21{1OL#Ye#K,녵2DE~ 15?h6'Ft kM_N䒅[jBVA%THPW[IlP{]jRtVa@+\BΩ C Ux zյn;Xdݸܮe@T95Q?hHQ$)Q[@KM,c&;œZ+:P$dL%XP OUwߑ۲J.K8T[[RqH!X0x͚Ȣ((>1Ql _Bʂ uXrgHuϿ )IEΧЗe}Ζ$xMmu3yfԷ׏ 5HqE7D f䞲Dؤ՟767# ֑SD:j5"yYa쐛KHfC Ldz_B %Q_ӳoI#}μS{ŬO@Zֵx)ءr± n2zpYŢ*j@f OkΙHdɦ:*nӵ.4 ſ&# Q2^ uddɬcN{4󂣓rcq;UEYSIհ|ͯΫ٬8Hh(kT8ymo'ۣ 2nr_#M2015\pv`4ʺr^9O'UwC4Ł,y!Ez}O9儍L Q|T\y9P?uqԁ\ی\qNIjZ7b~0c v'bgBvJ$Al%C*ŭ~} Wqp5saE(G${'>:;;q+B"p< R)˲R-*[1m+}Kr4*` .&aA 8qҧ;T͑wTh}L^(\߹XqF8I܀V4vcyd Nt-O )JNӤxOilrcAMA VX ~xdz?=ZX:b9zۉ*Diy pyLz+Gjog= A1'PTk)\:&d %sȥ/}DW"6k /+9Od_zg}9<}>ߴ BY") M ѓ_S>*q5(3 f\K{vVu 5;;\ *AG81 )1)!')@=/٣7~˷t͋<T" =ROKU\LSr%Ϟ9!N# $)(}.]au\5S* Cb1aQ|}1 T[ɞFsTs Xʲ.$ yX$'$I*.gÇ)Jxsq 9jf(rOvMtn[8 ΉCLN*Ԅ& ".93=eOE VﵑQ bY%Iȁ*d (5% lP{Kؙ_!g>)J}}}}^b?l qT?>٣.(APD  )2p^VSշϟ뾖ӯ{5T c2Ue?lc~X PBOHQФIْrr~Y(CbS Qg p \ zԓ76_ml-AYBRz/Ji4ۧʩ쁏`='4GNMLLww;]Ij݄ݬ߻SH u6B¤EJHA I y6.\Fן~&L-+'B)]8t~ʚt1EOa򶴐 =A*P8^ARƼ;%Aڬ8  no e 3b"J\%aG%&Xe!h?<o!fǿXkHiX6tDrzrPʩjr9¥J!͠_Mj+.ӍNq]{} {m)Rr* BMnPF4Fxqތ/؜aH I+q]18mJfsjj2jS=%($54D4R0q GjMғ'D)DBhZP+BuβvcDhfYE ˲R ɯ-4Hܖ&\X*S B?14$(pϵ|lOȒ$psffe\-T,%ED])8Qs!PH0yH${:`_I`50~Ջroj<^qYr#bRPHSJ$r9H*grۿފfix;XH)''M1N0׉0XQJ8NtzX.RI=Xs (z r;.I@ꇍ %5)$5MMj0$m 5sTWMJIb SU@!,4!眅WA*s D*\ w%AaªGzPLj~Oْ_j+t%<R,mPs%~WHBPnFڤ[ULS3劈)HHMv;TeǤJ)5iM*gN뉹n;xt%E D$!O;yu@OC/"!*?+3p 0..]ܴ'&%aDȺ'I`uM.]Jņ^7ð =NA B<htCF'O2;*`*jxjQVf& Óc;AOU?һ%)r @yq67ۑbƄY%u5Po,꧂BQt(" 3؜\2*_\MM` kY)Cz 랗*_bUO#E6P]֋;-rNSJ)$/GByƦj_.kZ{kZވUv+&={C-Uٵ\P䄿w-ečssk3E̝dGf>H߾sVܜ|remTԭO>By̧;s3yP@yP< Yvw<]My0>9"P 17<][2`WwW[OW;wQ7_Q]doɌ/5 wWɴWC++} =H@,;iOq]T8UmУhu}>/)l KBIHB+Ds( J!oQK(Ңe3/PfciBx I̙ss`cjTiy ,k2&_0 X@׶D0+AQOp煣p-@(rO^͆U^V !H!b.RF2xF& 5I TM~F`LPh0-8NBU\`Cؑk ? n9Ͱ,ys!xjQ2Ȓ1ȷ6.@ydRm/m=c:dg>tA5 &ʐ:ѱ41&ZrwX_g/n=YXxh:Wg]fl{mhc!nǫo_^ːF}*}@c"$3E_ІMq?6#DeL֟l?B6^}ϱ_sL-UeŘš:;^޺68r{]T'F`\g. 7ʏ>{0{FRCsKVhV6-yQ66Pcr/8; /Ke[=$[S1F *s#/ ΌK+|=21p-̥{p?0]\1m};j$4ʏNO-ϕovG) 0AVa*Z23$RL2FR@ГA'0a",ϧL),0 iŚ1Ȁ dOWlޮ84An4hxus1`>qrDD|8. êѭ{"Y-?^25ϴ =u=uSda3AʰK(cЙ=,dP + :*| =U uiep=?> r&G%Ta"=]qTNBW ɚQ6 L&e7s*7R He8MH4ᤋQN8ФD&W"1jVI [HE.*s/7(i+ǟv=5MAx<[ ŗc 4pRԤ&3PL,25&T (E7YRZ%X$;-+ESI;WrcQ8c`5 endstream endobj 309 0 obj << /Subtype /Image /Length 22761 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 436 0 R /Width 432 /Height 168 /Type /XObject >> stream HW[XW!B<"QAv0[wl]vg&FMgiatGI8mo?ýsr; ?SgWw$l6 b7 ͺtހ4k稍5 H|MZ]Cʢՙ5kqu+mrΆ[ײU F,V EQ8 @Q-hע*2ڂۉMs[ PiC0Al6ivp %܈ ']2H h$pk܅Klh& #^`>q5هfG=2vW]3Lx3 ID$B60#HmjSD E?AaAD*KSL`E1R>$H$T*j%KR B+# BnJaYTSiZ. o!4є&y$ DjFh_AX= hxhߟpZHjCe[:4ve8-a^K\O,7; OŇI糱LޓzƇ6ml<wGf:/&g\1z}x1۵K4ߏ(:&I H <F.^JLMD~'iaży}A.? u\8Sȴŧv07ܞnf?]q9d|yhdg.O'/MݯCwiyԴ\]M)'Cێғdfycmkju%i*-8fofSwK@>H|߉ C PGF}x70[,[쥘iӟ 5$Կy Ԙt(N٘stܽ+4MR Ǽb/Vx1D|ėVGa)x@muˣ12$b^wؒbn<7p{25UwZ"jvhB*LN@k43Ŝ-`Ld޳_0Xͱ" !5Ya8X+r0 3LX|BH4偣(9^2Vٹ.1g}&%{ HyqSB+XZ|WCIϞcqG|*mm]GcqjVUZUk"kj)tVbqˈI^ThZN jZ\܇ ۩6X2^T_ȪJXX .9_l˓#^U@~|jlw髳7]mfj XeaT*P+]"IfHvY IQ"eBc[*b@䱬+K//%ګх+uʝց{ .WVJ3cE\WΠRm'hS! (G)pVKCL䍕6yC5mweE=S'H4q_˝N{x0/+wgo'Gꛧ'^ӨطjGYz=ev.=A!B̓a.%}=y'UFrq1@$t !b*[ &BNpTMmVT`R 9 }ZKn{@Tv7of_wッ_⧦&`/y<;%ȱC}\9_ٷ8Ο/nH*l2&c)J)ˎ/~RT{{t֣emejU8KiX0]OgMcC{ 1Ie8N!_Sgrp'ggi|\gq.-ޟ_ك-~KMb8t6leȹg6\7֏Vo/mߜhseht(1co0eN>3oQXc<ύ座\?-*x2ƇICvǺnX,G&' ]7Io9l`ݢ/s[/wwy?~q7h4ב' cm(saۥd :ZiQ[]YnO;YCF’,@$7"~69/2jLೂ!zż߿}yoDSd 常?èH$QdWji4ft@dn#0Le CH*,՞~mEQBBP┢nJ`Ec\ĦҹTRlL %bH+zJT!{LgDױZi(Fp+ i|9Q(P|C^Q"lK!c~4O[ug@Dzb'<LK[z^ZZ-]-bzLZ>[&EҠU꾶 2oZiEf*&!@ҰҩFtvmIc b ŁĄ뫑(rȊ>@1͒n$0{P'P(@GU_D@,45l"dd +,`5!EaޫiN 'C9Pt|P =һ99A󀞽nCEP[AbF Ƒ wr$qDA%L\4BₑF)\"b4.E9l\+ƄIEB$.yCx2RFAv8Zȳ|}uU={ݎˡ$gKQ UDl\;P PQ!)@@ _ׯ__y9(`.o6qg{#[#F)1iTV' p|)re2)lY:a$QR eF"Xat&8J`Ѵz `T)J|-$,ꆺBgnB!aJDD?O:A7FQ7C>9,P@fdYhF*%`E#Klz.w\.U*DL1p0$ S) #8uAp(& x>g㽳Q_OMeYXmeqQlQ@F+c .ebX,(fl TËә*MI*5VRT) @% ڰ8˜sK"LM4_{˹}ܗ<-O]˅raysfdS 335Iۥ٩5/ק8~¥7<ȯ ]{:) ^0?,V{ J\nU hPs\ ^G CZCv&/|gwĴR>Oz-X\6sSؒ/  =s;,*e7͂׿(Yr+NsrGݬ~"W)$rB HFr҄GaI۬HxUq'ܞ-?w硸Cq_~}6GJj1Q"o{S$<}+bǢ⾊""-2###)5_WvK>p@Z3U!ep xIsnD)Lqc'% Ov۔n:=/R/<Qܖ32'a'6HvuH52J̓siҨ١ܨ)i3Mh5ȿFp6G toD:v$m!nb曟bC ~3#iSְihIpR2uq *11Ч߀]\8ȹX,I2S5l͛oR,Й' ߑ416>>͈a\%_FOdܟG 2<j,ns%^6ͺx3?WϠ-^paXT@$GF==z`X,:%c`Ƃ`C|d\enoа289XhzvKKQʢP@!X룊'euYkj̪KuMX^WYV_$8(-5# 2cA4H`t"XNgx%j g[W 06>11957?;;7tnY4^2b>,BlVV%]_E"DS.z`n8}΅Yluuuoozkrb}|aQcUӏQj! `fh96jY ᡂe(=B4dk-V+êasdf5l@@>̬;>z7޽؂؍D׫~A0;gc3}]k [_X!k+w>|. X_.{i%>Ƣ D4BIim1H65*@ (]mtQܠ@ YQ : r1 ((.5vcFH  9 pn#ڢb0a@XtZ_cNq_,n/귈,+^𺔨}uo?Z FsX\J^r΀Vztmn֜9sr}r dly<<_|q;Zو$3.ƒ9M>{ӊwt$"`8I@N CTbtVA>hz Յ鴾@nj#3 ytqbacT]L<̎1a5TTe5dEYMϞ=kN$#ч YP+&iE=- [= %XaTMi{ ʚkyl~ɛʾ'αFց [ׄ6/5q3[;^]p:?[m?~Z%VsU˃sAcA䢏5Cl& C $&ɡGJHnuѪdxGX 5Qk>CmcVAfA565>gup,2)뜼:5y A#/Z yb[ؠ86+00L4߈M~o+ "PdAVas4hEh"(Q0 ([ Zc3u)ɄDI&@ M̜_{K:g~q<I}glۦ^ gcԹ-<PU{,'{;(ݜEї͙YGE]ܟ{$Je"d#X `2 (3I@0T*V!F0cj*s۞H֢4J3l] {d6Wwr82 0` k*-Eץv*$ I@rPz6Zo–[ŪKL?)lʚ;ףZQ>ԋ|9Q&|Ւlms_\;0e^?E~= ߸ ]y7d$g3$vO>ELBfm|[rPC&ܴH,H=FMj5 a4 `E͠9\,Fjlh`67ttO[^3$>93~\gyɣF~Uݏ/ ~{vpR$Sg5X\eTj+jaؒ_ęӇO[]Y`OhD҃0=BE@BӠh0᳖ 1B!PK^%X@(%7"nYEe2 ۂ*bPk/E1z]'&b\Na]HXui1t:rZ&3U9¶ID֏;.۬Wdd.<7޿K%/}Üux=ϩ':n_|=}d`h*qOʕ_ 2 rjfFicƉfȯK2;t:D!f.7t:+{Xj0$"H nǞZ7ob2M : pG] Zw&bS\]F12,!86l&T,Sz]a-& ef^ K ˀı`%6XMC1r|R+,r %2`F7.0EJS %rx|irq- Hу<!Z.7b6Z7:1:vQ,˓5@C0"q„CكMǜۥfBQjŒG'I liTS]}} Gc⸘Bd) PI_f5f ̷*P76%&tA iW* x9*::-> +Oz]E-FG=RQ+j1CuK_sθFLZ`רY[X۠RRnMM ߹3((hF={ ?R^uq΀!ExJfd\i:VWjuCsgV;x8;ߧ"+<' `{G7l;-tSM[BFo0Nar*Nùٻ+NY{(4;!<+==6x[z=ī2# ^;9xϙ5:e4t4jq,eߵ\6{/r,BBrypxBv#22YvNdmT-L[Z5}r~w:,,;\uVlx~͢BfUYK}̳ ȥΑvbTykly%?Vރev|-fy/*hJ ;QLCq&&+s'F $e!8ЬMۣ#[C6l8bwxc?Z/=y݇OwSVΈf~5$P  (>c!.8 I{LB2ydNs{ߙ\=`G/LqxhiUbAR!Iʲ5֯z 3 G @z{{OۼO?{xگ.歷ǑfG/k~qhA ]뷏۫ي1lfpZR=˧Xu王̓W?t@&zmn~9Rr;oßɏ߿wg{>Y軕=P/0^PzQחOeJbbݱruώyY|czj_z7¬/}b6??3ɵ^|gv/x{vp#WqE_AU.R%})HKWvVt5ȇJ63r)p)WڵW'||rz Ng3ϟ=}4?y;7>{t#{^gpжs'U,s#M8-ha2ά-&τE jDD2e}Gn>ԕ(UKKJ8@K8ܬA eG  ;L:+dgex;BPVpdl@6[r z1~!AP(`xm-n+Y:q@`BGLe:7+"DA*FS0BEA8 ȑY 穾O r $I&#Ld|MD +w1vyrLP} 4K$$A6ASdL-aBdAL$d/u0QH1Y^dLIZrչbsw9Cbo Ⱥ^yWy@?st|\jh._2_\/y}n>y#Dz;'(s*U~$9Z8(IEL6$0/ CWS 2.?F@VabTLSDq^.K=Ԩñp(y'a![+"[+ka0﹞sidbƽ(W# -~\#M^&oQTqlS>(M\gM}dBMp?Ȫ"pఎtءz4IxFQ/cڅ:쉊^]z4p%{<E]6F/ C]JC*1Hp\{ԖQ73E#hv7G= 7}cnoָx^TMcDZxGMqfu110 2ɼw^tZAyNfS&v^@bA v 5;Xo WhPōܼ e~ t>NL4t,!)Yer1$m:r^`ӄ:րFI4zy?Z"=`?fn%p|]Eɐ~:._U3pLIdKTh}L4sO1 4 jv ^N+[(KO" Es]QX0׭9O=;w2zk˙<-*k7^ݯlo8sPTʒbzyQglT;RN1jT[MŬbA&}2HX&M/`IYm튃D +[` 5ҡŽhj%x@e7*jej ]4;L8p؎_I|IbRk#7v4ݪJ6]Ob` s xZcUgfv&֪|9o|9,VE9_mfH 1T Y& qg0H|yͷ=lTzvR1g3߈i+?[9=[wW͵(b[\Vl wzqs08A|8F`'p7ು^~#[MoA.G& xH*3YKA2.TbA7th]Kib0t=_HodKC~T6yxBy2!(WO3ȣA8,d%L˓9JtcxWnrl( -*;e!B z:hÅD*j8x wFYLZ*3 УZ]s*t:](˅4B+CBa;'snޯz IX'W<⿠E)V>0jo6:px5XssRr}C ɻwv6oo(uj{®nw> ;]c2H(PF5?CQ7vU Q/qXi.[=VI/t޼zwO^˟ȵCQ/=ׁp_X<~TFs̈_/ݻA?^]S:t: ZjW-)|d%KȒALҸ@mj~^|b2QaDd)d"v߯΃ /U ~(O=2g@HH6x!jhM#I;uĥ$/;_^I}}OtZ|e5x6VXWFفrWS BFA 0Hd+!SLݱr۸i\;8fJu@'zK+z;|fG"Ʀ)\ksϞ=wR @A$ X%zpg &vR$l;̭-RK q(9"@R 8[`yo$,Iz1N ptH6xMؼj@c^$ 77w8:;bMJ`~y4 C >_6?`]F} ZyE@ήۺ3͞DN;|lt xޱ C'cTe/B_;wW%МX=-uPt\9k-fxAc$Z_AE%Q w[5L.L8n>zD0={1XJwkY7֍W Zsb= ()O1@`8$Db0_&[I;S|%7I>sӒgr038M&Cn e 1Li n# O>n*_~&<@yOf(4qfFr⠫W q@j+HHØr`a"A0:l"!<$HzhD6@(Ժx}S(@pߺ4k[dt]_6ׅ"vd񞷯7 =tbHW1@t (;r/2Nހq0<$}p 굇荑Ou/rs\?>,;'!)܌lɟ샤^&y>A;ݬi]\ Vx~AK?AHˆY>&W<={[f@?RK` ;1TeEC@k79<8|Wf./;_dI72eHri(̅՚lCd;((rtPu Ή[Ol|;FEίzϵD]o[2eۥ9"jL:oj) GY?E|%M<`JH[`:ڶA渭Q;MpYֆ~:fLɗGnO>O)8oD"{uhmmmjj{{Pofm Tͺ|t Ƭ8Y3v\{Řl xP$ڍhJ=ӏʗ/]*YYy)-x _}e1N&ʊ1dGM+@@8}ZX ڵ:Xmi[ D9EnF@`qB=1B9M۪*ZpxɱH3S 7e1_94>i 2|*Pt5s@i7rq(|uJ8/uM-ߥwit:ÆAu},$*@&WT%Hun/Jv D (EZ] ԫFƚr(ɥvc[(B 4z/xay* 4`ePtZǣ]Е ]iJuѝW 0Jḭ2PX>>v]ZHv>#_-/",& pVRe mCMb/R]3LݨQDO9>wq-xllr~rj|G`4|:}AEĘlfyX&vd$f$Hj$%"ȼ;5 ^V=n߾_xxVd3J'k>6rUg/5O&]xHkHv kNq٘ߓ4_8Q\*Gzts[9mX._ŗ|ߊBtxIR w-_V\,0a\()#3\Ƌb*,TLJESd1 zZѿ^Oi,[X41₲ 5qAWM# $}qÍ[8 /kM]~nU=æIW3=gN6ͅs;"~~vf?;t^2e{7P\^K坾;SP^d~Kz `DY֣M5n.WvW>gEt{}h^ &דDjkLA>+x~Dg[襚dDޥiəQqQ#vt 2O7ӓi_+gq)9_Jrj<kE Q CkxڥsؼĚ&72{0[[¹۫k*uw5w)k8 U),^fYra`@ ݞ1^'鿣5WZh][a>j|G18`7!pJ  VSZ, I#0PO {j8'iw7U.8zÛt<M•%&ZTN)/̫.kȞJڳ*W'y7["J_0.~Q52diMʙf>&opAMx!~,aҳT=/SJGx1OM0Ec|}s&tcw2|z4aQ78?Ϡ'U=#ý#u*iN55?68ݓ!f JG69 ].=/ *pψ0&'4m0~֫2A8TgYusūj&\;xs|J\W8i=<Yo8,dAwEHxTzUew.,&pջqۀ^63;q .$!6E߂W4 >@ 9H@mv"/~g.H.@p v"pqsR|a]s5bc[w ֫9Rt8z@8 Wo>@^ [Z#J/4+ƾpk]b#¦U_yC.YB6ptC1;??K0,-3* VZ !5It0ZBD٦%eۧۄy d`|B[̇,$'MhA *>| Nhx/wW@~ C;sGp ?<0#խ0P"m}kHmA_OuXl98g‡]֫?k!FR+#{eq&Snф4K2b-xPǶ8кnvW603ELtws7(3 5Iո=1FA+&zH]!5fEY \e%,h@jIH1+TKnŃX^d>GŏR#cbִyaۣOTk\ss3u?6ڱ-@/e .p$" Ə& zH.2BؘC_ i7-&8 8fb(C gy#kݻ5^}ϥ Q֜{dZ5k;6Kr ,}]jq|i[oқ֘njvnaQ(7l!^ qQ د6+1`'|\pJU//DQZ]Zqҁa_vk kޝCI=ޛfg[q?d\Fѓ_{F7= v~Ipr\+Em^D "#5svv.X!k 3 D!HC$yCF"dґH((a>'.&~zC(BjӑIL&,5>2-,nl*MR|VRU ϟ*GF 39|88d\F޽AY_ \:5[|0x/h);笿mx{)_A>,;ئ6 R;ެ-|FWu=$b_%C$ӠeS7+믶>'{> ޛ77gud_|~g1!KK̎ŚD?N`Y>s?+s·!8̀̀ol"J~_@s\ϮrarũF)L: 58K I%Džh8>vwp/@y^ikhBԚjW<{Y\_|s" DWԳA.ʳ.!z~_Cٚߞ *JzՇܻ!HJ `i.Z%td Lqf,0bdtA"*"N |+{(JdTݻU:_s?Ռ,{`M@ fKwĚfF[9p{/=v# \^А vw80v/u_>d!utכׇ[:B¦ Iq[mзii!'U[MwO8O$8'#EQ](IQEH!p:%zO4r(~˟o}n_XX _NϠ ~\yXAw)7\_SWh{ΫWBw^/g4|:Et֣TBvsynvއVQor Ҭ#V1|VLж;FawΗTmޘ lp-onCǎ;U:rTg8;U_N- |RUtfގ[Ak+>ވQY IW*Nԋb&UfՠJȆ:SXϢOPĮuE GkNEl(fӐ]IgxТ= Z_(hSQ LG//}IcoBfƍGq-(yn֧l h ,qMtgbþ -[r<ʨ_^L>:b1o6u֜m%v7ŋ2l}Z_҇OWgϿ]_YoPSBLtJIWsZxf|ߔVOGwD~*m @H/yHP\+6}B*QdmIe}Ywtyݙ]7i|7wm.z<;CR;}8?|x k3\Xzgí?,/'rTݽ'kw*g oUkkkN`]UwT v{2ozKwZ'ǣ[ڱ{hoT,3nFF0^ nߣ4Hk(T8(/7^^=4:r[;ۏkc3۟|ȦvN ^ީxi=hkMHPA RV %ʒa`i1T%*0S!O\! #@B Erq @m<\s8({[Nyƻ:O7A7;bz~^t$yg1Qe͖h{\iL|׺ha440 ǁFca3 bYZ¥]e!d ~{.t >xsIgAiUa0mK? 0S@O(RCUS؎ N|l7c4pğ؁1GGq(1HZKh:hЉf(ZL{tvdSy6s(fW{B*L\"vB'0Hp !VYhx fp`ʓ($ҙ cQ L}4ә 2#iE]x vʆ(Kl&,ۂO-'˒" ٖM@B#PH6VeaYM[ml U6±br5HnĶ՜ ǿ tUt= endstream endobj 310 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1195 0 R /Contents 311 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS0 1231 0 R /CS1 1230 0 R /CS2 437 0 R /CS3 438 0 R /CS4 439 0 R /Cs6 1230 0 R /Cs20 437 0 R /Cs21 438 0 R /Cs22 439 0 R >> /ExtGState << /GS0 1251 0 R /GS1 313 0 R /GS2 314 0 R /GS3 315 0 R /GS4 316 0 R /GS5 1252 0 R /GS6 317 0 R /GS7 318 0 R /GS8 319 0 R /GS9 320 0 R >> /Font << /TT0 1246 0 R /TT1 400 0 R /T1_0 461 0 R /TT2 459 0 R /TT3 406 0 R >> /XObject << /Im0 321 0 R /Im1 322 0 R /Im2 323 0 R >> /ProcSet [ /PDF /Text /ImageC /ImageI ] >> /Type /Page >> endobj 311 0 obj << /Filter /FlateDecode /Length 312 0 R >> stream HWY~ׯGiaqc2^؎m)هG1W&5c TUW}QDNLn޵=[c7Bi⴯P/~fBDVRZZ )bO)ՕkWE/TJl&ocPV *˸](: Y9HgBO=c֕XD%/QײҲI~Jde)Ig$VSAµfmp8r8M/_9+DOMe6V4bu_ns96a66qp~CKi}g>هomkXʐUZU`~ESLzDt?y+z"W٢Ҕq&( 42^!Y)kQLEp7Ȋ*c#`d ^._) f L`p"lvijI*1w<2FS1AQ^hEVǀEV=ɦ, dxc;4NWEP@l#À!h4#؛1+(<nl!13X<`z3l#r.~o?P{SA/{<:9vrn#>8kir:XExFQfpP&땰ѰHT<)a UZ9\J:т V7r&I>UPJʘCIFρnëIѢP eGX{+0Xp )ͰµlșT4Bc|P1JY2{% urz+YQG5g~,Ed MB5RH2A&$S+xs]>'-lh.f/9I]0HMpI4i<54԰X~ab2ijrilw4>؞g!= J3t7R h*a?&S@枤Y7 %Ǯ_,(I!ݏ8:%#ƋWomovr{Y\n6Ny}i̭}:g>&}ׇeA0-Sgސi>zNѲ>4TVO1u}щݦqbΉϺjgN-˹L|QԳ0qW~L9sil갌(4Ҍ۳ & xVNWQȒͬ!.`4~Rs^˸sbMӶۯ0_?y6xTcWK%m{Fv߭gUb,%  v )Qы?NĎ>Oh+buwuwܼIa?bXz셻1O}u9=|5YdgQ$|*ne4!SM Wl +:v @@~7L8cDNY-=<"n\[;tpsu/Yz%yM'V)iu{4ey:nf_M`[qJ 2_m: E`z>M ;))dUSJNKv ,^՛kDWeu F?2_}1d0fd<} J7wtMUxb8),؆kTX* TepX]P;e-YsQj]Ҵ1<;qsHGERLA_N˶_zqs˯CIM%ڶzɭbNGkv.k ڢ#+,4 C3)##/bؕ[)t!4fP`DӫvcwV䧎TSگ<~?>&[p(4pj(TfQ -ǐ ܷYöqG.oڏfamj2pȏ>tu0CPky\4gYAϊ2b7iSmq=_lN[meוnl92=#曋Z=,g:]tV8G9ݗ//슫oE)O C^M} LV9Llpc.8 L30 )mHiՐ,|0؏/kT 9%gGϾ罴`6;dW*18˫}]__2"=#1lɪ;xeB]/X}h`8<.oww?gn{u .p*8"<='3;)BeЖ&ceUVEd4UP#FžPْYyS CżfSٌ bUo o?T_Ia .L47WH lj; 뜀^sRQ] ILVM!3(O/W[1thNF.M(%KxοmKVV0t9I6OrH&8>'+ Z Ь:yCe C:!Z;)AӮo+]xshS#mrv僭-sf©t`XecyVo%"E$rxĕk`qÄx*'|'o8ygNX<3=z[{!]]ϕE=W*[U碩lTNxluU,x]{ژf @P|8ٷaYx1l1N:35}z^no8ӦvgIS}N;u窕5f`s[DVE4 8 icBZTIpfoǥIC4Qgj5S]ء߸Jʀ{Q3X{70ֵ۪*kEh"to[+>aZ Gq|E$ӃrF!VZ/Վ%]kYEocB@ġ6`=A/VŒsrlL&MۂeAUZ,"|[ŐYdP^%lEoZj2dcS&`Ydyצn6\PEZDaaj4{0W WS֎&;5EYpTcSaKuq,Өwatn%;~bdCl܅=f^ď3>nDbxMU,-DnEtnKL29.倕&IFT^`T5@T b]%-ah<308*j;b]bع;x,u<3#2tt^M]p@#IvcRtUh{QEiI|}4eI݆-,g e9n3y@Fhs CllUŸFeU%#stMD"AGMb9s4;6tZ6Ҏ '%j$%Y= 7D:G&hc~ .f*F3(ƚ`G4>|B#&e0$]5ҩg!Ix `BEԖ7s$+^%z0Ak]osoO)|PL8ƴuq&xrmlN r&S«.DݯfS7GѴUU3VK9Skgk]bʌ jS^0>"In3ZiXX ?di*ɶ,Lmm$džgTUM|g6otfoE%n %t܌hWZ.-zEm9lBzj`rOWZ*dMCx]l%WY`=:"Y\^8@g.y|?|jo=wv7fj8qȶn)]P3Qktf's/t,|˹QXѡތ0Mi"1RAaw0o8 o˜IXC> \9jOϟZsH:Ws1'b'U1S~Bwywv3up] qX6@ :=(TJ 6{dޕR_|r}nl)飹.k d"2ugedNsqs_H4dtJm(֎v}kȺ"Ov()5Cw*&ns[fK> ?۱pߧbL:CX,Oњ0.[0RevAՂFU\#EouVdGeD n PY뼭e|gfL\ejrB nӿ8 #Oˎtcm>[=flBp:okO.yW| 9ayoVƗH娚_%~ve= UNRWKKJY+o3izj"u\%׬״GH1Tʅ$]AQG F4mJ"X V9uGqMx%6vh Y2p<>6LȵXbi#FmWn?wMSƋxٝo a'8m,[smĮu-tB+U3Oґ ~']wCI ~? IKlp\$x.̚"J gTG`d[C^赞Y|Ԩas~$ʡpkxI 5E Vk&MTSfD'[ QNϹt>0@`ru,juvn<8a+'pF=OUEe!q$^0i$mJ;%Uщq~oW>O; 91lemDW3Eыh#E oA~fȮ^1m%iXTNq1+@I0p w.ȤtGfiRx~hzcSmXv^Ӳ͂׭U9t:tV喢^%K y iSWag3 endstream endobj 312 0 obj 7834 endobj 313 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 314 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 315 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 316 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 317 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 318 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 319 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 320 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 321 0 obj << /Subtype /Image /Length 35161 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 437 0 R /Width 378 /Height 259 /Type /XObject >> stream HWW.Zj313b6 Z!$ cH#;lbӑv8uͪ޽ݐé4Y.WIAWd}Y}RMeӺ9 ^e֜+2|$CdWjp5> "4[nlDwM*i>-foICv"4F0F KCg,h>m[ѐ-ؗjO6P# ~WL`AAq'6F(a8J8UG-8fN4BAX"ŰEQx8&: G4ӀgǫaJP hT Tz x9QHX^+u(S4/,G8$#B>~asȦ!蘓yK(Ea(X"sdPps #pTpqml>0>_&?.H\VCiQ,Kzqz,YGCK~Tj(_n9Nۿ7m9'77fZCȝ8wqdvݏ=\_K~}O:=u&gf qc~`Z?X\v9:[:No8wܣar?_ܧ[O}]{n7f/E ~۪6%jU շdn! .D qg -sy/˳skNڷx UbC``qi =[|Zyߎ5&\Nw<7e1twot:|75ul޷zUzOׯOlKؘsz6ɳәcMצ뎓Θ@ #O\k'OJ΂Heyc*`,s,GXÞi`TRδ˥ >#3gjQwy@.T\c3D%!B~.nFST̐ROEBh{7V ,c0FV[TpI( 0όJ< D0\. GbPYNu%{ [#a7ù TD){7}\t*2[8sws7p6cZYlYk;6렟-R7Ә@<[^pY.ʂ*cp =~|߰W_K%wV}Tu`.M~]QRlK}zthUP-dlj穊 V5GQ mOUY_2RNGjbҢ%Ib/%eQP)+AIū[GD/ 7|<оLˡWX%/GMGPc?2EKoi7?,c$\C T\ ~^Pѽ0*%TW- խkKѵHCl$t^IutkU[Xums87 yZtm7uhra6IÚT^Wn^ZIroxG(á~_1ɟ~zowo߽*63Q{ec816C#K{6*NjJ,(]tIV_{ئ]>6!Rg7{>wfjh]%@_W 5Еyc8v|Pd{"<$mU03c HȤm~4]JҺ!S'֛{_?|wt%*mτir2BE"<*F+LX"`RELuY^F@! m<=.Wx&ah&* "TQ:zc,ZG[QyDHo*B! _BE#(/LKׄ~79oΖ(;x߄Jg`N4uViy3k;^?vF]3k|r2$O<"#GEtxRr M lM: :ť )U)9U."/u L0 ZDHΪUë[k Oۉyׅo?ZY.dܟD:>ܼx*ko {.;^.ĝʺ=Z[!ߏ#c FƗzd,b?>rKb멀 =ٹ'c*pwe?LUT>|eLqp/]l47^L-c,8q X=z藮IRO֦ލXy:ͫƮ\OC@* &TT5~ z2pGHvjn>OaC|>Ct;=OwSE3% ZgI5z#^Tӕ4:dH %sVfrH"́ hJ DL5_tV֥ڣs)SdсQ~+FSJiiIN5r߈yR&KAYSK%39TO>tO'2`j1pgkpUh. 5^\yljPr~]>)giz&)8S@+:Pxu;{{4%)Z~ /'hҾlU*ihYCG=k# =k$vQ_稺Rh\R@nHgggNi NH=5/ ^4H/%Ea'V3ƀ! 28^J: ANg} l1,-i2T[f(*[ _$ ۳'i`U+e6*pq4X/J,lj͊ĂQET2g`XVA0bYI`'|P *(Q8_ C.4aGrpN?:dő ܛPxZBqLi%,'iD\ /;ע,p Ȃ4Vs}&zr9hxЏW5+qwtj:iZ+M?_wxέJAAl z;X+(A=;[A[uɄ3IˈxV7&o!-; shjC$WW f:@$i-iʵj0*EVҏB2>E"Io&]n66w{R^6._5}62qp143Ө4X,w=|0/CWY [Kvs|t/vUŵ݋nnKktW;}ᦚjKCn!Ut?}PDu!T`z߮wԦuNͯͤ)ŷne'p!(Drc~/D֟S~W*+~}mOx+zwKX,M_?oO_S~%K5ܱ-M]-MT2iƾ?aV던ԡ!ŔX,h XG J_%T=j0}L|ah:tcuvbhh.:rj`|kM{QwCɫݗJS3pj5Hg*NyR`7%]X狆j:+fOc98C> tSIyVg(A_O|׻.^Q%W&Q٭e}(P:8-gFT i}7 ^JХVg豒l&,, :Bw-:KщHgFxHBKkXv^o{́yi G_ux|~5tL"D|8֯5Zi>g2pHÄJ, |Q!BZ>fI S㖖C]񬍨R@6_ О:&)ŀ1f+ٱ_צ2u+a> LPǑ@h0̄qv`w;ò G1GM,H p\"yL&Y PiDynk` j ŲЇeH':R_ٰ )eBɸ0 #7YWH@N!Sx4#-t0a2VlLTD8@ sAN?vj~P*/12-d ]Dt:x*O+#)xgH(܁RDN`G:~-ؘ8f :$ G:(| qL™ePTQUr%XL;z}nUU33ccc ccc3 333W\‡O!diiٳ?ȸ|P"N⏲a^sA -&qB<,L9H.-}rWӧ>Ư,..@ GLO?3G@cc 3 k c?>}txk<}zvѓg,,„", #ͽz}%J MϽ<׏_|>Oo/~w}~~ٿ"<Ͻ{O6='zAe?p@s]6nIY/3uelLu,mil%kL1sT4i&[s22+rZ0' {̿w}vWs:n. ;-Vbk5{U_mP<ӅB!b\("YVcZw9\ c ._(@PᴖH!^f&c2!8 $)K@+da.IA$)9U*cY9AM4B h>4/ @;cPx(C̈8C1ә10äADR_Ƅ`@^j@^0~oqـAHRǽ {3T^/Y؅ ШqAv?vxNnwIn V+mbuݱF"{f36VWPA"qt@R)1:V wU.FTTL2DR;;}mm R}&M[EEo/K9-i:nǡŠNiCm1ñ( pm(7eQ<$˵+u:x!cs^e4}~n|&n4~c@˗c߹kGg_NI>̵6L .3=lR޵i@#fp+,O%(:CxTNb U]V= 3:.fl6hU  IM"qRHRhgbY Чׁtk5tsI@ 3vlv FMw ՗t BZ-JF (\)ʐB˹фMOOi 'ҐhZMKHpJ[¢盯c+j1X{e(5 {t¼f]4D)=%;{X0cc?.-)i1P U 'wy K6rŽ'.O4boq +/̫e?ldJvm0"D+>#FPg92 dO6у:f42R4I: 3Dl"A2qeenkg76TTEcu yajnl]M +v:ªoLebM_?~ k(SfBM|HOéxf_FƾnE Pcs{2>dL<& ɺnٗ#(!^;hiO)s_FBQռ#g~)(jIQ|uؐ+.[?J9r{\QR#tήoO_*(̠O<- ?ʐ$##I>beTb`/^B!! #(aT *=Hчl ;Mm ]]t: ?06@AGEG/Sz:;P>˚|b7WCy;7M1) Wg5: y_ٌ,/O3jU I'ԩJɿ;RiTaꄗNo '9lL3={r=+ɇoܧBC^Vcwg7N}=Z|[>DKIm{J ꎤ{ww-;3 2ip:A!Ppa vx-mH~":GkFF6:!73"Lgԗe)lz}Sw&ϡVnRJ(W.u5ottg-56kV嶾WgnYn?N{(~:~mu%kI>|ʇs W~FMaWo8%ɪ曁Zb[no˻wx-^4#NGp.bO;-Y*k$k;;wwǤoSrODմ|j#$"bs)e6-"M Qt#m{m38U#F%}ǵ 0d{{VTƉx=JK--wjKSg%{~AgY3ro4Gόſ\Z];PLMujqjJ(P"ª"Z[ ҡ+uUH2H5[tP^2de_ #{@};wzz:ÙiXdO;F>7\NK _116xs~g^xA~Ì=Ssz/tCDz:W}ݽOM`@υ N \? G.3 ˖:(G''GPT00<yl3 dJOfHy.C`5qsHwAh4)X'• m#cC?;:0RSO:z8l C̀tL}{lk/8ULS_V5\MKK*mcv|Ҷ y1281<09+^xc451?9<4:sz)hWG 9fՏG|D< -vBgBSh $7A)7z;I$cw ۑQ1"!FFȟ ^op N>xө=uWZqDD=:92_YUdf}ǯo޼ׯq }exPL u$N ,S,A-Ώ 1&]Dyٰ9쒕TY4m.ܨK?lk{ q@gg'^0Z(e>kU}Č`w'{{3]nwNN%Xl>!P!{ w'e{><0СCGqyyi<4,@&ᑗ8{BhD&pӏܫ7?qG?78da ;Â9}0}dɂӃBvNG'-Jt,)ZdVq&wR@eMCΟf-|w`o;! ̇JJSgnojr B\X7X,C36 6[j*'p,''c=ޒ[zv!ZOr |wQ,:7oV):/bޯy`aVpxW_jv0^:7<m憝e5Ry?a F /y$^Me=r:7u__+jHզREu x&Z"claGg*ϵB[tȮoOZNȰFB-2ANyfT klq+1֥6ql*b{wy OtG I{90?uq3cҗ3XQ{kdX.:~jeZE&IհUzzNTjEJ\R]V..jk,k041V)Voͼm _4֊xN7sR$v2O6K,5+/Ymwq2bR1OR3T+ы"P2`84y8yΨ`xy-OxQГ֮Ļ}V]bWa\OW~ʼnOpFΠsL8#Hp:+07 `-G#n$êa]XUc,cQ,Ts,e0_rPϥ拁ٜ͗q 2nE@6ps|";Y{%]TljcK6mQp6mJ˃cv Ͼ՟qڸV/f*v8 s8S/ݤ[/oJ;bx!.>h&{Gd(iH*s3Y|ccv\ 6(m`Bʽ.JWrJVGNZqF*V-ᢼYeYd8ymE[W8E$9]$ <t P;+9HFxVo%QWDȠEFF%24]ڠuk.)5:XH]N2PTlMF6¶UXSC+@ @ T5Т#j_i챪V,/M*JCia5`b媵0?/:g)jjkkKkKJRjj@*--* ͫKv0gXA||Zf-xaw-x UIKKIɭ'_#Es35n!VQ),cbG4.= ,j"v+j"t'!4 I27\%"e*aeijk E0LR5S5?=|;r9v<+OGK^'3l(c;yFu[Xiu9ɼc}fD>S64[y~@v|6xTJzvvVŠ.IPNU5KifwR>tJI|bCgOLR{]($_\BR9X%A|u;bS06X/' ST&8PK"JZW*qu\Am2FD$'P&M3Y fx"pP|;;a,(_P@ii q#s0:3^a3Y3%[4E ?촄2$^ݹx$QAR$$?IR$‡GRF'qݬ*23k]boOIS~ aQ}>T834Q[( {0n8%/s nsp $7 ?&s܉ ̻s ˓o ] _V у<#ٻqz,q(o`!#m7?!ȒЋjnNcfR1Pw :iKj.MA[652TA$Q‘y fQNӳ?(sBvsvHԒ7KGq?E4=6 \.KQ }K4Ayb΋SfZې0q;ĝ,/o2v9vE6Z.&j\l}7T::oQ4.Z >n5:x9u5-E@ᇒŒM)Ed{|^j;aM/_j!vAH4_p vh䬍*@|6 WjGX ×>0uսۗ7'\;n'XYzGRmEDiIfRgO?uXCrzRX{J(oV?U";'޿:. [%TϞ.\+(Y "ځFV_O,d5r x՗/jP,m8JJ#GŁR ,T ~p _ ?/&'_ܓr?ao9tc;,G| C04yp& +~O3j[;N> ۼzݦi9=M3&)pܿ>D5{|Q{~4TJ/{g3L=Sf3>9CQ$R1}1F_Aw֘sHOR[@T, %" Xt`V?اO9%p9jC?)+p{vH)%ę&{4MI3tzЙtIC=i #J2@ b,:71Iؼ^Z3 `ؙms $ #O'%1x/JіG;i9KK#h4k6)N'ٴeؒ~=~M6,>h bS.]gkvA΢Q1YզOX7Vu]`\|0ƶ+| Dɟaۥ݆!aE{c7+&825$վ¾Ÿ/SVL!jljN[mVkc o3j1g~i7hB!@G02 k]֗Z]4mQp_+oAkFMmsXv\W0^WflS6\a}O֫), &QTeS fw`mmd-RVҀtCw݂J s~ECx}\9ωc$ &c;H.5.WRMk_AkgyXaʼn{'<ĭYF \.g 3og! dt!nHh"фiyy(%{(gR<6NTOۺ;B^X˕nThnyMlʪ,7Y1fS8Fk7P`NkT)&نن`%C9]$+ ay8H;:'aS d}*$WAa'tńLaNFG O0P?ZagES(_PCwP|:Ȥ,M'5_.zsd׆jڢ5yޝSWX< [6^[umaJ"dRrTS]wV|XRBTc W"{b(O!MvmkYL. FF&]$^3ojcm^F|N7tRR*c(0\ ɴX):swŁFm漢F܀Oy.W"xko4Au/OO?~1Q{aw]N7LsV_4гm}uug<޴یB-/4?Fw_Ϋ>5Yyx;%&N F@ }WJf=%r{n>//{'z.z:{rc]:]?6[5]U9F z"t+05n>:fzFvO#k'ǝKO/,t{}V˂C>ϼÞGdF5b.ZdzU)M8H{|V؄R5ܗ

؁!÷ dAJh|$ɶgG߸$g3kya6;ltGe1v։}q㉿\SiUhh!8H(ECx _RFG1,{`ǘb AbO |:6ΐt#j x(~wLK1lΫXJl?󂫤ue]Lh2\B!*Q܎ٯ d9jX2*H8,L-Gl1# OF"K-Zh0h-QgykD aU qʖ'%)kmwBH eMMr)Yd*r5Y즒``-UU]Jx;]A 8|\H;z K>Zy;b'IӼFKF0RȺbC)aX8F^)&K]TVar J=+[VՒʟ*'i9Y 4D$QtV h< 8*U BP*`ڲOCV˄%k3 ѐ Qh$# ) R$g[4:)ORrZgSԶhK"(h\Q0@DŽ:&)y!|a2x:H1vϊ̎sCg=.{[2SjQWX|J6q 6~Of*M4։Mk|шw| i]Ek4Cͯqh߯f  -! c‡_̿~XWyߣ(0ycmXviǴFc <Ã95V@n6GW(DC#>Y<3otvJ| "Pr -rI4E QE ]7 lD!UwuԹ/.P(/ tP@RD(/LtqLG^OM%[I0} B` $`\pæࠠDe 1f!a`HC"XTY 2,V! ZU_wKn_wt9ݷo՗s!K"ѹe2S17Щܦ 9irXᓃC'( A%8Nߜs=pos y~E#CH} ܌ ($2tȸ p#!'aURB@ݘޠh <Q*-Twi@h42d4&zr2-2$Z-GX]m#di6Xm?0䛓.@v{s{..bgCǰk<ILf"GKH`0R*)F cs1q߹ A|~ 6%P^^I'ֻcOnR@q|ޤ|`c_}~17Ա ;3VV./эW.trPcoMi 8dS1DUy-ADUkX4=lеqP t*LTfbSΠҌYxSѵb>萮8<|EmݾsUhjL6q{n03ڛW_{ts ;k ޖݚ«  k1lE19(ρl\%&3Y#MJz)$RNjk($w䚀ŵӕKßeS`p4o+ٵ7V::^ݚ<S=}C]fًյС>NjdF$ 73I!^qkSk= $Džۘ7مqGR.#ΈHl0*5zEGQ~DYy!:xߝez5+6r>۸c+?uT5ۿ/,,\o_z;1̿W+Nʿ|HޥGVPZDyR|0{L=$=22" b2AlXxAxD<4, " Q#o% fƻ۩ +C_UDz{#"k}Io{$V ,8+<#K="IJ 8eAD({  EtSRmΥĄy!7lURI<&rIL $R*s'MX%pt: uaAa>X+(YV̟%U%?c-w .RX bJʨI\ ȃ&nghX |A+Bi8hYBeIjTt8[L q j_)Vr9Sr䈼_4K4VTMySKqlPRAXh|ZYM xD|wb|jp&@#ĤDŽ6% (Q|AVmP6Cȳȩf ʪ JVJ2˗EG/'F'~9y㣣/ǽ;`T$Cg~kq!oM6oomo{m_XS}֘ҚUE'1[&=Z6CÁC܈8pHxRk?TpV#>AU HF_F\t;q|Dy:R;wNqJ X%c:~vskkPX.̬/l}XX^{?]ohxr9kuU!yYb,uyaX3 ?aAuk,j`1KqhM&`Fh4# 35#nc\8:pMУsls|Ps7nJ㽩q"IBx6됖21[zX~IW@勵?zG 3zn}]+,r. "A8|zH(Db!J]P8F^+eܤ˹Al[Uc )|,VRkӍ*֍U}d:us}vswhv?noάn|x_~] doPWwCn>E$sؾyނIlZIA-9i-# a\.ƺ#3.98ګ)mt |("lAQ,("~UEmvޙKQkgJigd `bX2_|$@yOfyj,&ŰiIIe{4y7NX|ݧO?ޏ,A\˓'xOӣGvcO@K崋uO KF&B؞_r:/^܄~fxpg]a vyŚM3Ȉ:nNaV]JG%DW:o6}W(_ sq qq*6y'Wl=B 'Cʻ!^hX(zYJrf{S/Qͷ =z{vpᣅ ;+&sy Ǻs: 砩 ̌%r@TN-Zj! ]=]={So9]1RHET%'f~bɤ=s?O?{YVNwP>l<{8TK.CȗkfzQkގW#k3He7N_žUq%ݵ[[=O4f F5zM({'<`!ZE:>wbvޟxrrD9q<%qJz=@jd'+ zΥuz J\N[& Si NeR"@Nп]j]}s~syF6ڜ*,LqdFR K}3Z;Iqwj)'T+ O1c , ʁP Rwe\t;bU|ɂG%MgCK@"DH@VQ3(? U)h̤UE>_. @187$g/{#ݪ;wE{:m/$Ub$]A_bHa-S$UintVl&rIXwV 8k!ϳ=_yWEڸ|E$D}9#o²,m`Y2Q"děu(f$w+\~!&Zw p=oUPN(){T<_ 2u"n)!~dY~93:$@~7 y$%XWjYN!h4,(AQ#(Vkm?ChV*NUSݤͥHtͽϹ]|97vXHD$ II;ϧ\E"NLGF~bͬ|nE5(֝&+ۚʥ{(KjI,Q(^Z٢辊I㐿㑇2F\+2,un5sYe`w x9έ?8\u_!Qm{onuC<;w'g'AC_G>unqvNWъoںayry^lY1j. -wv/Ѱ \#,aQ1@Kox{1amx 9Pz-iVxP2Gꛓy!ԇrRJ s{hdfu,8[X&'lz;L{Ly{)yoEZ!vCAhz[3L֕#_ UTJ6:,nXg(F8vXA-~.Aa/8ގ%( dlPRmaۦ)7]QґcfQ4hSt >5bod'#DUUM<E_'W}87 =H.Ò:a`xZoqomgG}_$\T|S3iد+VBZWGjښwت~(3&uB~#'6Ku_?9dvKoOt~Z|3=%=ڐ2b! xo|ujXzv;>fjZi.t{4i纱lˆA sS ~aյ1TssX^2p6u04jF{/Bm^TC ɝyD?m;SJ&moqՆ_?wD~TrL=CqFw]%_ո Cc{uou:^c98 ˩ Yu1ou]vy]8&P0YCl!KT4lM Xk#Q$J"GUx+;dvrΈ;!mT~R);E[qM \Yc:9)61`5쭕6\" JMQl8\lPDզ(zal)#[5_DZ/p5f->K *5*6ePǹ7*F&ƳJ;tPZm^>ƶ[Uh I&&v`LR1Ayz.[/R0Ǫ{=kyYX]7ߊpv<N4 chGMnQI\H2Ѻ5 Ӹr0 Si~&qq $4 ل#8-{}Z |@|i|)_D䘯qG@~U~!_3,Τq4d,K0,J]4kyOaZRrYUROTRvUᵢP! #=I0ɔSW/{Wh/oVJ^I1o@5XKPpc ޸)@$w2PaV\']Cz۞vr"CCx7|!BSOT%A`:(Eas(RTMLb,=Ne@;߾Z4S^K|<yw:{f!B#O]A:%^[1,1tsܸ^5 !ڤ1 1cL ;iߧ66ޫOif~}9Eqщ =4% қǕYvVXY1DKA4~N88O0[~!]y ȃmd[(s b8/}[>~ߞΫBiu4;;MPJpg% zX@]ZMkԫm|UMϗþ]2Z;[o5U#܆|6-D*4C!M4i%qcu~<^A(*L#Qb1uY;e͘nn9Bc٢)ij /kg5P'eʼnx>Q,d!IXF},50)*h1 ۰L{? M;N t0N2eněMJ"Rl!ίy6]K#7XBN[|Kݚ|Z[S [p{wP_O 0<4giӔoCّ}*X)GG ;0WU8osϕJP떐Y/8|?dXB~[ܳTlSv|_'HS"~d~YH9eHңd\ü}87 m(AytQN# 0 * ;{ ia4A`{f\hK0K+W yeAeo&e.o~wzOT6)fPaepSQw]T5@xNcV N5ppʇGJ AZ9=|̳F-\ tf3(@fin7Z$_] 'Ώoz&>XH-)Qޖ$äYJ墵~E^PܐqMIZvFxUUY9}ۭ!;T%mbr죀mt0wnG4|>Μ[ [F̕\Ai *.gze d968;7o巋j΍ Q.2;/-&AT7Rf%}BN6~9?22kr#8XK_ȼDrT$W$]Y5M(x2<*EEDco>gvW&9γo6R&O8m quX{~EQ!LX$ԠYX`D]q^Yuv8(ZK_VṗNmؒ7HeX,p-o #I\K4|XfM.;.q[9W# *c $bpp}2, Ǩ6FMS=e04 QEr[AN2Ђ@,L p\"'e" Vmʬ8C(``1N)Ϲg|M,~qB">W$'Ɗ}Hyƥ3Hymq3NB!cw1?Q}_&;ԣHyeb _K @ygnB &p$gE >lB~'6DTX{}۾=Ck6@պܱd10CSkC$#4_2s8U`[I@ h3w;EtUJr&ָt7/7\jxͫdBqduF,Μϼ8ﯤĐ ~ݭE"c3IQBN*YBiqB-N_¹W&>OEPZ2OUu!a;"7ШXS̎$m,^m4)`q֤ǫE .k1G8*1<"Svwi-E)m!-n(HHHj4`дM7#9ӁQ<Յ7¿K-8'mǂu̵8O'jXWYs !3G0>O/8_q<m4(+.8\кЂp`I?`,`D^[ev:m _?gytqhe3v,ţ׏BcgVR+,ML[q'Ou75WgRD/i+{:Jq~5e}ZvzŢ\@AUrAJ7Pym FccIĔuOY@Mor>9 )NRKA:1|f繪IsbMB$_ߏ ӋS ~}uZ&kewNB/[R;Uq!Mb$ [Mr9,:upp{ APrģFpHѯ/lH͌lKky|u(?EʲK[DOSEJE1m愪Tߥ7Œ]2v8h#osqzzmQϕ̫>,*#Vmci"un){w|{{`@bpӁL(n; xQϋ/w{}H+Kx@S^r}OXea 48f1DTuGƋ]ӥ@dAѣ%J (  CW{SOE={EJJ U$TMbT]1uSTK.2;.P5/\Noe_bѐr2Ye?]yX]Aцy<wB(v->噪b3aF9S܉rժښpNG :>هYqw Mᔌm=ao>^59?/WN$.G"*Jc81c#FM < Yr^ޛ$23pIՐTiMurDYWfTs=Os.]l6yn·lq߲"&ޙݵʼ#/+*ȘHhOiˏx'-KeR2(TE dm8*7~>nhqfbr>9R-Fz%|y5U?t<{x|blSZo.>Y(=ԊS}[Oğoc>߻T589ߜLjj?J^r:?}MdumS@M= e-1ղnrv.fGӮ}US'tKz>nwJw!ļγ:ϏgN6ƨ:5"ŭGSGڡ eK52_b4A΍M;uJŧmh~*a%؈3QOiv+Xk1P@wW6WК6w5+pV,lCPCcێIٳG.W} #΁~l-'^2V,a],w{5 m٤Q^75.0Rf>z=jBsW6 -1UU{&U`z pkZ+l+H$A-h^$GHdK.8!R)àR<m2 I5f2I\?9?pRB jI76nùoLOR6$+k z\(3Y4WcjIѧqJ^oTb|f_eͬG,.vZ1@-&D `7pV.H^7G J;4Ǣ@s 暸$(0kL_='7?qH_D)HTMCA,-c/J(T(0O *[$ha(}94cE wzpcvϓrzK iajdUbiY d O'SNb(r 2X"  ,N1S8.C܀w$E٣94&CR&q1$7R[bzR_6Ա۴?qy-aEC{[Dz(&gq{oK o7ydu bf+,), =Sw5I4*?&\ /tlPw/± ȅ,_zEn(*\sB%^`my1!]s.py<4N_[ci.@q.F"vՙ'`PqzsE3rM@kǖG:أԽ\7? 6Je`- r҉wot/)9ԙ_>\POÓo}ؠj?:==KlǞ+=2ǟfxya6b 0g]l6 rq)2&`F@31~˧m /9ؙ+EuA?>QڣGfAA4c[R d'/EkFXZuuUս¼if 2%4=+ 0FϚ5 8 fo ?ŕ}gxzri-N08IUN͂Bey/4l(m<_{x_9RŲ3fF1si.khu I|_‰VjX9 )9l Vyoy>Jx^(K^5:_&?H&ͤEx 3zfB$;4? [@Фne,㯊Q$٤+ߐP!!DI~ a 8)$j+DD@$YCHM?b"*1rHIYrxbYdU%>ɐ',*[|l(8ulG$2=, ܃26f5W W*Q r+7~,5~ 1Ez,_tdNf ϵ<۠<6{.K+\=7Ct3֣'QN[ahƥM WNmE`ԣx*Bo ɷ}+#l)c UBWε=ғS3;_V(2k5w&eCEmpma_(l/䏏}vzx&pW`W{34Hʘ^nؕ7F uo,nBff"/wXvGc/ȞFϓ'A!|^GŎAsR,4^s+[QHUJv;u秬r$XyۣWv~=hq_͏Ŝ0c04`hM+n^4[>B @E t}7nY{w-VQj|g ] T-Rʬ'H_>0M>mu/_{m=Ƀ{#cmz1;JM*4 JӄM&h2`R@{Cjix~}h%yV\kiiyI>Hxm?`B rkȇr6iI?a?"Vٮב)~6@˪(hKNԑum[NqFc~np݅mh,:,Z^ԛqI0UT"`ℨ36]Mn7ǹi"Af`$]Č|:0ŝq|5l  jķcrywSc8_ETbw" DHq#aRm[tMQZ ƦAX " ,PQ쏊6A^, }]V(:B|B+5倢6G26^2*]uLR\)p+$:؛ %@HY¢ﷆf76RXkղ?KRIGFVPz* 'hOBaSQP`0XlM!l2Zԓ! z>xM^][vɅg5v4Iw4G2W|NiNT<``;wE5S__I$0|) g l %-^7NR8 ?ȠӔ> ?D9](("䡴l;ũG#o7>?{VrF@^HPK{4DE}AIP &IEl| !_Z $JIBw^wb: 3V} t/7LYm9DM/=.fc|]UWr(w7DgT]*2[֧FF2=SՋW_/ˌ/,?x537|'mƵ۹19L> +_VzfsأI%8t p}{+έNʼnU &IU`f n6EW_A?`xrxsqdj;!)0q^uN)o,'ږ7w6h!9I5+Q|`iPVv啷O #Bj܆*1ܓD`bAhI q̕ K0 p.)˔D,zzXEV3:^dכ("^5=MF(&?FpwJPV,fGÊ"rΗ#?i&PǗLAfݣi$:)pda $9!/" | GצPw:~$ 5mA ӗP4 б/FrzŨY?D-LfU!AO"H@k6T`lt;cKCM\vF)ɒMt)*_TFv*L;O5 endstream endobj 322 0 obj << /Subtype /Image /Length 8045 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 438 0 R /Width 283 /Height 114 /Type /XObject >> stream HW WZYSqCbIT\"E̸}[NAbDLғFGs̗%?tOM ˷E]q*7Nf7Km,4N!s]Ñ) ݚn1vr6/50dz_Q+VuZ5|zv))sufsI{^izl-KHU'צ_)p: Muյ"K"K2홟.,W׋[7i/48n7)=J`\`5 ]s,Pm-lϴ=P/+YiN@vꬵjjTME c"/ngۆtٜ)wSE\5Ռ'Šg[1.;@bpk2?tV.4xve`)rw>be7}  pY ʗkfW(0,c.ķERD=wDbI菱Îc @cű@wA~* TI>8G6t,KMz1H}1`!AY DHvTҀZW5rj~ {s /T x0J (O.cA#a8g^tC7x PBbR2 :.r$&5KpDqENE8r< du[{I~LDjldp-T@bOp/ʦ+gd OmiͷE)4j4& : 11$WCE$ML6L&F2D&Of2T' 3i~n;=~xo,9˹TOOpȜ ӻA%+i+{|>=\3DY! J٩iD .6- 5lA1|rPKh0i tvV!Fc0b-#ߧ`|ENm,EIXcg@HBhHB hN?7LeO勹؈Go%^k bL}]%3tk/kMHpE&IXtQ" B /cDz)Y#V޾P'>XkS-yY?zp&zRu'mEJ*<]O:8[`O^ơ1:ݴ%QU]Hj ĨbQ @ F"zBQ!p"age Qr[ec3mL5oP-rVrWE }n )vkGFC&3jKoS^pgO5cN~Y2i!̣rD!D%/TCvMjzֳs/.7_|#BTU5~)O!S([p׮FS[~ኩ(7 R7 $5s^ F+%A#Xk(qPvD&3 a\(|a>1譩մبAK4]8Z A8yx}io#OggZ{K ׾-,=l};sה,/*N:։iR= +Msݏz>5wh*\l><6T6AQqQZM֎Ӷ)нU'KoJlD3Ø"r2ѷ'%I؞>xl &+Sp"U(mBF$\#q^4&}=]cjyD+@(i(FF)j]NlyUвXve 5t)FTH!dۏtt#Pɣ +Tq+TGRypz^Ipu#PVB舃=-t :/pOAjkPa\A }]Tr)"։8BhnJw:aEw^;+l]rF{GlzToT7$O pJq!E& $bmos(rn|ꗁ-j_UL 4 0AEǐB:HCÀnbĹSD QښIt {-AS,Epg߱3sdjڜ+np}e+SM#W|==Usr=#v23pGYm3ZԷLgLpc2::c3)n_0[ Ųod;Q&Ek (y}mJʝ ~i"5lLfE.ý&q/]'Z@Kczͪ"t I /LyZ2?X /Iي)XHܫ?O&f,:Ӹ_1Ma|cz?W .\SnkO> 9{Ӊ3mi8G;ĉ8_9`dۼq8m9L00;[OwOn wG~L_gf@i| >R'hLkL%x8cB_ȋΦgSZG5~hjz{g*.N0 GySnri􄗒;=zet(4>󃇑խ\ykyKIDF׶qU4"!h^ًy*B!+XJ!;V8+zX}UAAk->b M^hgt: 0U> b0 ҕAF@i5:,Z̪3iu56S  IP`0 Kk.T:]A|I&N 29 @A Vx( 5=௠4N<82NC<=g|SJ#K".  (b@G)r,H\8jY]`lbP׬mnT*yE^mMV4i9y; ̻MZ*V!K() /j++5~!)vVY7j2e•]YQ)v_j&;E}P2qJl:7û+&## !qse0[$+Xd13?+E Òƨ  э 愈2dD;q:<&_M,bUzу[qK$NBt дb & v3T}Ţ9ʳFrvWho*vNgmS""4TY_9_[]!Q (Ex˜$JV8BSzU,˰Uk x^-TGLSmY6UsdEXI |id($t`8v1ސ~x3ҽsLd՛jE\Q;njHc _n_5NDՌAŎ$';us07W{]3k'? wIcּ"EEǡiz{͗96:.NئqR~ub{j?FG}y1xYI݋uIc%1ƪ\C5{\b5ۍfYN(t4VDJܹM)%63;c{K{ }Rdtf=sT^(gZ{c1Wiv2M8Muշ,9kdlOuYJ9 7J AA ~ E-"b#F>*FR6d{PɽM_S{gmLWg9bQ*B@ynWK33Kk*vlܿk_OVzJƐ#،JʺBGG45}tڭ%mVsms+*x4Im+Ti8|ī|hbv UzO|?=J:MCƐ<2X{E2NѴpߨ:=6xȱV'fPCE0rVi8K0A GFuolIE!$ܭӨzuBj07Ꞹi/FL4ߺY-LLNmop2M>cU #mh\a CJkS0L>:+PqaKh@V(SIR G4 })*ٸf h'Gc jCK=o"XL.\2 bD0""h*zGp va2Æw*ͯD/x~AF+R 'g E.{Kpû~Nu<[ዓQĤi o{mx  g(XHJ DM`z E mCBS5@(eP@=ҳCpTա3̪W(2ˑН EL^O9wuVz{CNqD4Do4X2ͅ J5h]{Ϛl%b(!\(X*tGl2M${,.*/6w|3pc8 V((z(.H܃L$1_8tbt/oayN;=z.&dɫMwk`m`ۊ `x 4(yTIAVFQ$ epJ Y,^ \S d% &b@T0z ¨!]Qw3U(Ӈ@$VBj /hS0LGܤG B %k$..'0ַ\MUb*ijS<=[iʎhnK} W9_$_4K*]-5GNqOggYϻD $Úevn^}8i~~~^ssv< {~o :ݴ֛cD{]}8~5#ѳ3̜͖tz>0kQFP/˽㓓Sfޚ:T?I ,㽚U?;;>nM 7 p"aڢ-M?k8;ζ{%rѕϾeE__n:2ylW/n'ErPs5kmbQí_]$5frg/H7k61XwĻpybD QfZd0g,EĒ@*g^fu0 j( x> stream HW W, ɒcl6; !iL`$+ K&diQ6Lڙtڿۧ2a&sNw~gJO \mp^fخY1iS"lLe@SV\yL@[PySyAԇh8E=}EWG"\&u v"=92;y(Wzn^E݉y#ib dR"Sp\Eo1__#H 2ϐϪzI[2Ҏ6\44|Iyl;ՁQG̓ӽ}#ݏ~;Qi"װiǫGOn.=vINxc#K''͛[OOR_7>;<:jT'zK/^&k\`Tpݻ[͵UzyyǍ/='Oo4ıƏMRssN `m( hӃ` XHC4 =J )U*C!).r{y{Ϸ<[]GdH@{ijՒ/uO"u]6pr=ˇ/msF;B[Mf_yolnî?LΎ]s?nW=کUDГCwr=[=NMC׫Ϸk{F^˭j;;;KAgE.Btp;Y쎣ޑ`(,+4MRtx GoKע2-;\&IGS,H#l1`t3W|`xJ Bީ0[A~A<~咕88L<Db\'.PYOm`rZB(HfR*v00zVld2UwK?܌CމuZR-t]0}nաSZ V#}QJ,Q  gl=gfC+ZzZxJdAl)rKnI,I*,Ӓ%EڒEAF$(ˢZP`AlKRdlKt*MAPpIZ6(Wd4G{(8' Z(* -ڷ3bĬGw2 vLK0\} vS֣l #dÚ=m9 #S8E;*ҎI7Ux QGOa !pĉd XjAhu|99,u:8Ъ˦TstoB yw(j/]day5VO7J$p*s|P.u>nN/eq,:ҍP̑؈뺐-/7t K%$߶z6SB8 :y˥N;_xAH *(p^ ޞ`4y:M[܈xCg&Mm,1, ̚[e6)0{ۋȉ7gm}7us7j|þi3Cttm4 5[sķɿVӤyO C~w(g~-?_WU*J#ٝ1xĪ1nJh2[E)6Z[[Y@hAy}@ *ً=fV}}$> (Ӳ"z󠭐Tu3+Q:@.eqRVk܇g|: O>|4<Jb=[[&eJ@H1/I(!xTF&p~&s% 4`RG-(HU/RWXO@}I$.z8 rT: RS<ƈn!@ujz39>E颔3#zvK#Cl.*ÓO{YO=þsz=k}#q>&.w;Hz:/#bf݃`ʡ(|-l6?np6/Ajι4;>lȣ{G}C7'F=~p\ybsgֶ{W/fK?9Ѿw=SaR{ m88sV ofcLPqk2S˾Ș. ]W^oNܼ؃7J.f>~?_Ms`>WW˥3_2`sMM>;X 8FFݣ=:8F6ockP_>40hs7DߤJwo4;n`k==!@:/Ě_YF ؉XpSztTA#)pL6RD"<=M2)xQ%)6JfOs% (U|W"PZ@ ǎOx%aq#" Ls9{K Iy5H&Aգz/-z=Ow#+}Ϧ$߬*c1tt_-KLeL)jKe"-a1:Lc 1:ա LUa43M)u6i3eO5=9ݎg0 bZV`bfVL &56o9mSa*>%,eVoYU4l?V.fT7T32XlUOdMw֢aҬ̅x cvE7c3Z637ɰلG hd-XUI5C2]i3HjIb˷Qo`3hA-hmu.v$g Y>{CǼJ'aaMkC*y"{~Yڶ=ك+ = SY>T`C5T&p\sfP6䶩MkeqVM75 {\6aJg k8,u}}\K-%Y kY!0ضhPN(|ZUc}MR.+L"\/ECMWks=]SЉ2N"BVZs*/v< -,# _`Pk<#* 'AY"Cg-%JEU@U*6H bTA!h" )bb"҃_P_XQ^0ITɇtNI*-*jUZYd)EڴVDHJ7TD\,m"49F?n^]̙|x˽{{䔗hչ1<ؕ>?} D;O+fӟ@ȻH"0Qeh,ZFk+b MFTjo/(K}4lY?$?&{e%D wcqۇ*=NYt/%)ϗ8N xpLDݲ%vbYq@>eFX!ZďBiĔϪpݘ}3:tZDPHɈrA=Hƒ%h.Q:x/F%| dWejnJ. `"U5H)benE׉bpn5"5=\<Qg*Ts1;걭nQGAX<|}Vߵ0;zKg]˵vH ^GNolfNeo S@=X- G`0@c8 9' Sr)YͰYc8kHṞ.tT89.~@)= ޿zNẕ[y|vevtݛ* 5F*3 .^@SԽb4"Y!¢^\Ir tp(зVxzz/h]]׼㨤xSZQj K4:SۭQmӭϞ:K97ye)<{ez{Kg8s DHkJVtVTOjs݃u\pD30lhh= A2e*w!  XQ _FQYDB‡VBC-6w6ԞV'M!WΝh<9mEQ7雔ft+0ִxgL#NGDZ9WWHy&s@JRӅa tA# 5vχ.~|[/z#_4@Vdv3[! p}V{JSkqy<ˮF`f+99 J\!Sl_ơʺ狕DΟV <:~j\83VcGr-fP({Z@^:$vnUk;A1 W/S A)4Uy }miY 9xSyi!Ng@p x|  A @#C$!yx % A:$`GD#B8$-~)'FPVqtr>.tVEϲz |iR ibBA(| Sl$6'Y\(j8/M">h10X9>R&Ћ'6Q.76bK^o*-rJWTqIT-pIy.\L[|Xqt8?ٶ3OE~t l-8ӶBN0p>0 !Z,誟Dof~C*.>Vfpv-an7I ,Kdv HXg".$1d/onqfY"%XL;B)ps:eȚ_*/T 2LF0 `J Z[IRSn]-N3}*W 9n4rٚ2C. ِ%Vr)7 7S榦I2$B=o7߾yۙw@|fc˵/ ׯ_}۷gϞ}Ν;Rp8w N̢~n'j5Sf2t&#_陝,h,&DYAfl66|E`ٽP%Q_KO,G Ay>\>o$NQfيY64QWfE7ON>>Nj,F7p>qVB8sfbu$#QDJeD+ABBFu2k",'煇%" ݫp!ڀaV GS3t8j峰xFmBR `"6T 3Uk4y9 ^<+nEh)*%&#ptB:8QO}gK:nl3ê3Q@L:+v9;yݮ uO </>bE 'YEYZ'%idPBQ"G\5H$_joXV5*W>;`dw3V~w h/^񵍬-T}h75H5*L++DQ aM|9g;:;>gRGUs:,tjԇ&j^gZ)LLF"VjtOs8O={g1%ïl0}6㔐eQ*_1.T]MI+k%3Sv;Yy%h?,;}Z }2E4VpSJQG|*~ ŝN^fn:/9P;tNA&n`M=2z[$;,ߔ\)Yq:BZKj̊{bS 6ih~Q @VG{,pAKsk@Ç&>G ۻ;;:6wٍB@7tXt׮7Iǹ¬XqeӞI(y!5s[țk 3=u橗áB*I=)v{ܡ9+%sTÿWˁ;7}_ۗ_Դ_Vp쟒Y}o(>{:fˋ6ƚfO;sx.}(/>WC٭~HcIxK:G,a5(aq\ghNC a1v"PHD -" ;YHY o}}–b;H+daӒXe<9:97^H.+eǶ벜l+fM9ҹ韞\=c7lK}$?)xQp9SEy.KEtfDJp81ԙs>|4Hqd!m{jyR);9gVeIIOU8ȸ|k=)G}i%_EOdm-QS j񐁓m h$Jv Bײ(p^\p˅ڳ2e5A?>bn/1aB%'D%|˨1IKع ZRٯ-1G Yw߭|ƮކgoOT1}Ax÷†>\༯ٻ?ܒm;~,X2e!}}5/lev7.ӕy/jnrWU**%셒{{]r*hJ+r^K?&k瑓+ޞ\-6G `m?, A./ "ށ`@BpG "Gai D$$Z,)@I,pBx8 v'{]wv}{wP@zc:(pu }]?9kj#oZ`%ˆ*SKf*Ja*^.Ϗ=w\,ě1 m?)hYók*xpjo0gg/NZł kq]t玁29L -7#"7\٩}h(y7K&_rk.oYpIA2jlbjb `8Nu`a ^T'v8׫HUPb w @Pe8H{3e{%|w79M cTO`Ы^i`gՓ1 BzRb>K4{ ia dyh]7LSTlSb%,hI 6xr'< i;/~qlR0yP |s5I^hpAA #˃c#N%M 6XL=z]YdC ӵCT>4) aWav0~@ 51 X֧XʂN. $Cen~+gO '/N:`:TB*%Ѯ,taǫ~J_^t̼~%ԋщ񑅑XiA4ahvG?1g{@ η{t=h, #te0Y`M7-$لI)E؎gI"fad? Ae\P>:mlx[KP)l &{y ~v>ʕ|ӏ1bMՉ 7Â6z y_͛` ~ Pu@Mӈ0 sv3C ¡PzKLs֜[`BM/oT?ӬG_8!1 =:Q{xiðC U85V_?/;^fyb_3XOA ? 'q`z!@pQvv6(κ:~49r `n~87700??"E$QD|ssS͗p< Fn.^+`|i+w 0|D߃/a_aG @a6Za9, |' u%#E;v,ˇ33%ezbRyrg< >uqnaKWwU?O* 6K]{U ] w4|#UPH}Ͱ  V3+.jk500GN% i\myT*"ޡe˞*{l6$#v>o̰%^{-Nzf8W w^M'gqY#g;iQYƜ7Yl+eJqVej64 5:-gދF "ɺZLkMzlWBVTHwh7b¯VjR\F_e^}BNOc8ZpZ뒺mȪm\F}oyCna6%;݄ҠOₛ;R5KϯIVR [%BfêLRp &:(=ղ pl˷= ttp )bWfmCf;yQURM 0Hy1I-A57smUJWװ B!q,??Q\a?bTCk2NF2Ơ&<~[P"XCe7R#freOబn5~Z\_yλ>x,fX1p#] ?sWhҐ T2eH*TVNuu(NyꎤviS^+6Q5XK$LjTF<-mXX2cnuRI3l$=a|mDz]Fr!dO(-3˖%=,WO7I @xwBBB $,ewu!6ml5&xxl5|@VmE+ Rj?UꇪM3q^>xkVL&QXL ;b(&)hrvDG0h7@ O׻R(1Ϻ{7y+Kڎ38e~-\طf텟dU퍴V󀵿O]GB٢onZ5P57%k09sMh>;CO&9_09>F@R/T"M1QgB vk&~TJzؠ7H0,E%|^?*_3*tX0U`F1~/L"'dX^a e<zX&03k8"**eagZx sD>ݵ-KdlIP@ag2|tFW7CN423pRkF1bs}>rdY73"i ?ϋ xg#4H%*dY(3s12ح%4$;n0+F rLҼK%)#hAZkkDC?Gr]yI)GC!HB2ϰWEmͧ_?Řާ_\nb"{ҽE{ik[a/2eP0qi=V| t:MC$@h}%VWMWA:1cCRt_`vc3%WVw6iJ&F: *3^6!;JPy~ 5 VkCrChIU[qF|T]wA7h-yyI z L]+ZTM UU&}swǮ8{꼻OT${~O3{rdd mep- =(Z^19ľ^;0_m-16vhO??6oo_1pY~yKuJQff :k/T]åƼFU4>i9c90݃Ck|p9I+ooBr'wGs4Uϟ'd0")H,yB'l5O(f 1am{IXwjux)6}7ﰯ?aBvjImX"4 pIG psV{"HSCQggwwg'ݢʛ;ĺ;-GJa5G.q@yJobmCu"_c tȘG 6Rig.xU[lAH/Md^ɐ!3䐘gd_]\,<A0% 8߶({o5˘vd#ũHJ-v8EN ź8Km%04f$I8 _OxYQ"|9ԥގD@/##_JYmu~}` \DeQ t \ p5>)y^Mߪh1>Z6 mii֦44 㤸0%QFc/8IQ45T6V%k)Ie>l՚"U64?Oد\ d_N9=}Olyd2a?L7Ou_W\1Wggc0D>c/ޮ L ,-ߑ'Z"?_EtJ(n&l8Qt.JGiF`pp#GY4'/u-G\qu<2\9~H;}WW?]46?u; v"2zW @%%R\DГ"2)ȃza&(o@́ 4s<"8j9.eJ>q t  ȋ'i.nRl5>ZZmgoR4vNT6Xb%DSQ*N 4+j7ȟ*š3qR3.8kP69XodQՊd&5ka63hi S{#m[YI " MwJ$:P{E ְ KRQVd&)J^5T}̐1:-4RZJFn;A&)Bs)}Վ/!ۀ#] S^_HYXas>U+dPL"8s\E%_:vp`9/]I8nlexatWenr+ z&hR,ӗǵ翓_`25ab 0"淉ٌdD3}V+ۥ20T<9i5LFD6c4J(3С,Vux:}F38`BUV=ԆVGܠup6@-5h66y _g" [fmᷘmք oYٜ')㞕;S練 +n>^_<:W#7f^u--ŅZ 1UAmICai2 8Vc<_0%n$#hp!2$*Q%x!]N"Ed4w aX}۪TU xvܝXO%BۓGu-nN];+]I1q?w&C7VjAί^gy*K+t)mGs1zUEJ*ː"%V{%Րa ѳ> SXo?.+x}cbX7=!Gט700?T&o-h_`o[K*tZ&`$XH) 1"̂OJ_(.AzPdfۋWu u͙gRV=Wjf? 1"ȰRt.F3|VlVR&%{2sD: UlZ;bfe[ts;.տ zg>ch@zgfG, 4H i*y}Xk^i<ں `?b,0Bcc 7R1}h֜MaJCT2~IT1{6A>Rr5i&|(Y-k._X>O9́ Fx 7RJaP%Xku7X.5"du?pϓhiaXvy<=hX (fpչtD64M+D&aM zݽs4cWS|}ww72=3pzu*)!s~<ڼ|s3AmjbyIC>?. n(3GXhzWsG-vlOVa_Ѳ]e [`<_3̮]<]kfI9e|q0a:U-dHT%6JB#?^rϏLG-~EH%G\m ١h}zfgx K1(J441 !0h RgM9]nO'*F%l,꤁hf>6.G7.ٵ!G6Z,X-B/Q LW1zϻLTh:S*~N%X*+ Q]}OT +y1gY" В?MZ_*F|uyX%W|uEt~Ue BU,ޡU{ZVxYjdʲLMWb<)"4RRsI+d M9^x<٬0@J,RP%Ƙ*19u$N :qr|QJ/P = |^ʰIv@vO·~-<:mn؄pO DsYS Ť)" " fBMaJ>&sv6bB9 +)y* ~Of\N KNJzԛ:6_JK*V͚m-KD_dD @d?> 0 䬒9-$v\eK.=^jQ IS)ok9E\2(J{)I M6yIד$l6}qJru:zd~@1l!55T2,y/D8:]DD9?B-E/ğ:O/5Pp;\3?E§/:0wx/Kcn.ZU[߶qT[Ή7LiqZ N*HJV:Y^6䍕@\1Oۀ ;, S1QFq* e7rs)G'vݰU# qda}anhi8zm1w遵g|X}RJYF~"53G5gsɚu34W R/5 ]g_]%Mb722pwuu;4\Vַdiim-?88z bf (*hWMK. IIoXz R3[#VM3f8w\P[;<!;Y|,s^ o HʋiPYޥddb2yG~yo{o㗯_ӿ_ 77www~{7ubmm93'!%ed5Q}hQH?eE^Hd0Dԝ6K4Bjڇ?c7וC9e HDj0Ig QYG}IV6 ~êY-Mira/lc"R;KqI g7MwJj9a^l6y~QNo YN|`Ar2!>j{`x|uuܛgo\Urܙh4N:l6OT>X ~yaq|a }yGC~sهsŸc#ËƷ[=X6=`HV*V Ⱦ~D>Xw:Ut?Sӎ*cgq~c~c _y[@~ٍKΝyS'qxZq ՎJ%({~ˆN<QIFŐ^?a5xC{1BR斌3|&nn:l.pb*ewnAqOnZMZ%]m=C ݠ@5k~)BF;y):aU\8"'S݇r@`L[GTu<$0v;wuV>on>a( ?=r0>vk٫ zj~o0'*JHL7M~L%*@1z|}}p|?tdlt=62"cV>`u'c$/թ 6~rdaƉ<:WM# _6@~br _nK#:6,[1ricѰkX]__^]XZk]Ax56\Y r7L-mZ 3HD6DC lGqv8lR \errjaш &1?g'usjֹۤf0oP q ]`2nl<+K`__dgUU55 #G :~oe"Ö d۸/3Av`MWn,IO bO.Mwt=5?AHG 2 %QړN{sl"kۊ p탑;;/AA w\+5)lϣ+?%^L2;‚|àhp4'vJRʼnIsqΕi@B6}rUSt7F1q< ֥<_i{f͙#-ɴ:x/pi }mDN!0;,ks|Q޾`F+_,J.7wmO^aAa{JÍoygG_H?z|XafGWeMSȻüoI_}k.㇮㩷^ =_?ѳiۛQm`F7p:*ol7y7UB|D*Q_YS|2]KQ"i]Nֽ=5( pah:0B-<0L/,Z [vcL*0z4q%qâH"Z.|`8H( #^ [zTmbT8`µvW%U͆/e&Zh+^6+/DO% d6e "] Υnj:2%j,Yg7;'`wjZ#J7E= uT')*6N f|jK'NQg@?eX]f乂\, t^ٗGx_enuߏEyO:CSi!D Cv61'yxEɳ{˵pem,7VRs{8OEGQ@:yXZ#?[$;yѮ1IQJLI=i1bQJ5QSQ6c#flk"6ʮA_x1˜ynΉ*eF tCԷ>;*iv#cT9iö7̖#9%]φm ( X跹.\DDR*4qژ٪7mɚڤciX9Iv%X;\9%'VnZ%>xhK!-']Hx  Ma0rL5E*M$3|?.rI<쫼b^F!ߠ61!KX0U<} 9ȗ f Dp\}Jզiِvz%r4p4Xe3O-| |/.Ś|CS*(-䑒SG4T1Z(FqFN/8qew" ;֋|aGu[9jCvX.=YԨʮߒlhE Fv-*ų%-9sZGOj3֢DͣDmFB!QQiFƺJNmn/f޿NץhDU4JPzgMNf|-jWG`k^y7"Vyt|ck#) =rӉj2]^ tWu?/(A?su&kt17KvXk/&H:ƴ̍c!W0ZZ!?#n&7:ߊ|{ut7ה]pEMõonnvOJA=*S+5P_"ʁƐ5BZ>mN[uuwf2^t&:ʤ@̘@BRG#=ge.[ryo7-`π|`C&^F/{Eu/MI-+Ie}#殶 3 \%]ةZ4[y[Uȓ: BZ@[Қ'9Kl+o֙|Qȸ6TkM;MhX~A2|VkBUq$ D5^8b ! Z&YS[6,PK 4|pęl:<Uݽޓ?$d٤ѷ/{ofSczue`*" ~7~rxCԐl֞mfضfVkYhp1=l(ͭ__}9={S|Mkf;٧NMjۇ/_}=!aWdw'OT`T6W0q(QZnah|Z=eC{\oak0ǭŋԃx6៟*_?Kf*>kp;afd¤lLu l>Fy){v=&Wкwռdy6^؛OO P/m 냡&\hTx-!8F:TrbɖdtIJ\ y?,7,/5GM@ruYI,D%S%l4-)\lfUB+ܝTLܐBM焕;)VVzU0&T4zUjyTKx{0^ud]wk|'jhr_cU湦s>nuSl!.c{WORB۠+L}:)m]81b]@BFؑ5}U ОzR%KntֶvXjTB_e!C٦þ;)s薌2/|>`wRZ}o`)Z 0͒6̸JnZ*-6'\뮖$8-higiIZc wZ]5=3]]3n\um6GW_ۻ$Z;֞εvm+Ft}f,ei"/Kw$sI2gf$wXf?-F;Ŀ~vK9DEӓӷ[ù6TŐ8E,Z 5 S׍3|ї >Pʊԧ<_kdcAm4淋{?bi\ ctMUtR駱nno;r50 >HD *+AGmhB:jn}_Ffp/<ݿ0Gچ"뜁5s/-{ZMUn]?+jlp)bS]j KU|w IliMa6*dVB4 ,^ "??l~ӛSCe6/l_ā[/cfC/M‘kB*3%̘+L.OOłL7@uR=}noHN k]eaGU_k!]7F18EL8\*`+8D<UqAd@ޢXx<`=:Vb!s*kfo,fɝl-fNfUbx\>%Jfʅ$5 Cއ>by`5Dm#;bUw8a&',Q8e& Jj yp u|l9N: /40T[74lIxy~Gedb\?³U=+u6PUJ@S0piDޭ*E[0런ϓMMS-dp'l` F k4Bn#nE ⱾG_5xwRK7%ŋ~rDe0,TeQmF6C9U_ݘU_mLob1QZnH@-2}F0Wъb;Σ$<{dc=a繋֞iI{ݧٗÝsm=6mmsLH#i'i399t i&&V@Fl22k&9spO\r/rح*7Df|xY2OTvS-E=HDU,*A?p&/3w8+λG^ϳkdF'8A{,w,ylNl{<6Kn$VO5mɄ- ltWBPjv4h2=cȪa4:߲=0y@ɯ߶3.Qؙq\4eI'I-eh^P#(j}ـ) bMWJ$uE̋0mHl˩ O<|!c0O(L={JZmr$O *e8V- }2bW2˧`LN͕T7̧FTX-=xbĊ;0O"}7~{dQk|Ve-#P g圍|cUKB<OXd윕#ltuV)?$G(٢yz<c`(@dҼ "QlzH*M-+l‰̷"^6GI[,y@{B,y`$a/&(d^.7cI5L?Jjwy+"l^/J-Ib T 3פi? / nl1nDvxBcnC`8 0c8EPW^Lp٣#=c+/`^diZNMZ1dBVn6@06 !Ƕp-BD]\W #nw\BBHz+ಮ:k%2kJ|QnְR{dfN~AV[p+W Y:Bmri~}$ꡀH6:HaH0˙M%rOdG(Iao( b%Iџ]? `f/fsCh]IS0&/{?EW(I MW>ճ8ZGMΕvDbN,P)%]6֒"cm8wGh6ݐ+_h ;+ p^fHS,1|ۏe^Ar19m)Y&ρ>HrʴȰ"/vg9;0rv6g+5a(mKkcCS3<ᔚ#qߏNn8[ <]W[Rk$`bǽ["@_a⮲8%l5 (N4.a(F]Q`dL2m*f2NVy,o8^RI 6@({lN9,wlz:W?e^Sx|'_A #OD`a2%H ,,ABUה<`x'7(8'"B*h0(?AQp3z( {N`ޜU_!|}:=ǽG) rGVx{#y0o#,}=W!X~Й5=W>߁mh4?JjOJh*ۢs41|dh5lUFN5,MQ.TLܤ =,3@k-m̫5l"p;vlvxȧ:uQcҭRe5d$3 I{mB8[JmgTv3kJybz#/ww_8x_j˼iK(_\Eb|j[#RRծ>^KR2BNv]Q|zt?/U?X} š m%L V7;">_٘VΏ!ܧqmP1h4<{w|=pCӷ|)p{wrR|ج6K,ΎIUƵ45wy|R&EW{^\|~ҕ+3lzb_Vv6wJaݝҌx V񵃇Oy}>b&2 Ե.leũ4 b1Rzݼ7f)3i3vߔԛ\S\鯦jj/yg [>>[nRCYҝ߮JjDI[T2Bt{f2Y.߁>?,aY^^ z>N8D(?b9yu<畀:\ ѻ*% c0~_?NU?56:'j0S5_WU_f0f_Z?)]cɏ3JT<8sy_iC|!Ho=ԪDq>Øk|4 `HA(YGeZoAS%xiTZ/vqh=+,j`HmgE{lLo`Lɦm۷6nC8FlT6;94+uWqY:SJJG')l\b:cD*qzIʨ7֐Ww-ds Z4]ʩZʉ45u$y:MKDRZҔot薵V{S@C'R%$@DBgR(T6&ʉà|\ rg׷+ՙz@J3(R ݺuUS+դXu#Ef--oh^ atDs-&p _⣻.wflB"_d. b~j#6h. rXb|>@\InڶRƘ/'l6C1"*Ϟ74S s7Ƨ-Vb:t9{);E2"uϰ=_؃k7ņO=GS`_qٲ 7 n|$/|V! KMֹ7_=C-ūc^JcY1}^NVַh^c]C5s2Ihi~[szᛕ?}i{` xLawۇm;)]̓7I8VG1QNk--3gkk-MttݽS]mᆈN1'B>'V*h;|z]N-\#0,ep]qw<]Z+QREڞ.f:Mlz~pysi=hϥ_=z1(Z.{Y,צTDHyfn^{k'Ɲ+-*>2M)1SӀe2\Dn%d0߰0@zu0)Gg{AzwU.fZzcܚYys#gS++_d^dtU.>l_l ssruUsfvf.Tُ &nUSZKKU"g_ۯe(p#(1c\jOwݢg~J`KWw%RB=mz{R%S-VT8n5K VЙ/[ZZ+wN(oEƤgv=kJs ˔gQ\.B.*pZ)^h#UMGXV,pSwßbtjxKxљ.aبCʆ4*[f0&?1xf94 H}a@ׅM B3d=M.Lt|qoj* TG$N˔Δ]1JW< HY0Ml Fb #H-=BUF`tSK$*eR×CN;+<_"K^wT3 } @k;,l[9n${dz\r[;*S8!Nh1rCqv]˲Eqo#_H#`Ok0%3QDHR9xHh!RD,_KWD5 Ą'R_> endobj 325 0 obj << /XObject << /Im16 327 0 R /Im17 328 0 R /Im18 329 0 R /Im19 330 0 R /Im2 421 0 R /Im20 331 0 R /Im21 332 0 R /Im22 333 0 R /Im23 334 0 R /Im24 335 0 R /Im25 336 0 R /Im26 337 0 R >> /ColorSpace << /Cs6 1230 0 R /Cs8 441 0 R /Cs9 423 0 R /Cs23 440 0 R /Cs24 442 0 R >> /Font << /TT2 459 0 R /TT4 1246 0 R /TT6 400 0 R /TT8 403 0 R /TT10 406 0 R >> /ProcSet [ /PDF /Text /ImageC /ImageI ] /ExtGState << /GS1 1251 0 R /GS2 457 0 R >> >> endobj 326 0 obj << /Length 7666 /Filter /FlateDecode >> stream HW͒)B rSdeWbY>u@@. =Ly<@JUT[ _wr%]{zo)'7Zݏ+oʼ4J{N0ʕU^ܭVۮmXPۻU.Ն;nMնUzvJZn21y k0wi#Ճis?tr?i8\/I8_ƀB HH~_2" PV vYry=_x_ fz*kB\9l޿֯kf5 3'Y.J2YZz9^5vPsߵZopñQo#lCl*+~5;7i7yNSs^{ T׿7g?68ΤwNb`T=،^;;PfTuYotPo55{肋ݴ\e^Դ䳡CΞmLCm-.7.g՜cM7FC?>.,Tt!煬rS9 aЩ/NSrgg͜L *qi&˱2>f?/oߴle~E _*I}S5urOooy9* s*=D^ }Щ#iq:8fj~Pc})*CY.A nul6b/(3QwYkTj:8;}e-*a$n8(~G?亠x'K(1qs^ʟ\.sqvW΢犛̣,(?9vCZ55J8k0c3iVqsge nVXw:\\+]|YXvTEmѾ_jzOЀCl]CakG<´Fv̫zݯ UDM aC^RM:WHCAr*r"ΉfLVo"G U~m ɟ7M)܉r#X#*9^d,h w$Jm$ lM;Q^B8ݮiZI+Y gWy:^bdLԎ̱5G]0(ou̐g" *0ZP ]Gjv T t]Y C C['AU9\ƸMRҲ^R9.ti[;|EF%4Ն|6ԟPAtL`zzwf4m=]4D؃t{RM:T[9 h;q2~5`@i6!; ;b́p!G$ +J c1nMt\mRqs=2{7WwkBQ}! uE5ϋIVwWaŐ<qNde!c ^ \|!Y\O8X'XTV{\[(fZ#M6wݹ{TTW`zsl>I>fӳ1n⅖w ?.% B h!STOݲoR9l4DFbpXpJ+I#I&# ɭȁxړK*'ZsAxk̩P90gN2d61h' @HÕЋG΁9X4:'z 7qR3COS\rAx+b_ÑZ:QOp -tB5cUCAe`<V a|(Dօ{ x@1ci6E>SCiF>chLTp 34e%Y'* 'Aap1HID ;mD]%'&܈"!$*])y4VvTBײ:U`I~XNG q aЕ:0j1蠭W$LWL{BdDSv!^kl$#WA7L[m$>Q\ޕe+K8J{Y! xwAI$&rtO]ŵSdBQ<M㿭7,}Eg|K!ρ@ +*x0EEkو0,h$%}&"C8#!}qlhMx&D4e ZFE$8G\ kAJyHՑ B6 k#$%[v@l0  X,uwq(ha;],7jRKLr+rjUN])wvB;9N9qk >Rg=1gXoט)K* @/0tT{x*A1fME$Q$3CKyn_ΫǍ +(h[uYlvd3]=lif | @{W6ٲFbXJ$xf"roYL Na-^DL؀&v+;o[BH"s6|5 ڡOK-=ҖDDrVk=DN?J$^ uŜ|Uk6>GfÜ">aОʐbh~7գB ?4)e>d%pΆ߾s)5/锕AajbQ9 4lه+AAŷ\+zeQ,ҕġk=Eki%˓=-m!ӕj:>ǃ|dpK9K+ӌ|#?m>\}r ~#|'-S:eQ|^qlV n}KQȐt/FTJ6jhvt1;ZJt ?&8[$+7e`9=kƐ~{{#D@G[fPmI!vB$ԥƦh@N!X+ mSsK/O4h;rIIL|Kj{)(zNP{ި 0GJ67RkKena57O`M&T'-ûYjŢ٭NGva7GyԲ_L=M;i+tišO.F!mn>*{M >5I:_8dJ;zX*1뛫7L7\ ?wOǁnx p}s=6qZU+Ajz i!quIAH{?ybNڼ'2rQ ENM6 ɲHszFzqDNUHOϿTH̵o$URѣ4[$>!MYwqRJal!Akz49bޔTR2"K1_MCG6L%БMkѲˮsolgӡJ,ic*.g͂46dC*ٲ$"!wJeAU9b8k9%>~n vxH~l (]FRM$) Q(DnS9F*nbZ˸oǯ <5'a,ֈiZ)ێŠ(HJl"_0#R#BC=r["38b/ lU}FBtjcQlbZcc/b*!x:zhRY0vvB|.ʎ7cI !)bm 낍s^=(W|ܑyUVǻB1;Ҁ6S&|ɣ> #@.q2Yg ^_)YST{cUPz3V-7mᖠE Z*\;]i8V_3DNQ~tԐ4{AooSf'(7+qP7EԠvf.tɑ,Iv;6w%y->IqNKfrN*ŬĎ< 2W`L|7W8I3#p\Ղ)㦰S$C[$ʲ0y?gK<̵ttr3|"^dǞY">z]]z7mrnf%:fۖ]#5lH4`P,+tibp5WÝLo42l%zϫ3Y;!]d08jrK]k/]NT;"r[xaw[\'اʜj~^j ZD%`Q>3z]? a_<J*t攩4ɗ؂.bWE H/Q=4] v?#d"Z"5Pnxr>Zr?}/ '6MGn2$_'0naRt]? ز2<= O6 H\Vy!vݣ8a^^ټeyհ#. z A 'rNO7xQW=*:<=>4\} Wdj;_Ϳ0 9 ũǓB%SdžcjvU[;Yl.. 6Mk usUFJOS^ABoѺvOZC]f}捤e' Qݐ6$i/Z  ?P0DyDbIS;[3dQ i=UcYť !g԰5s?ɦSS`\ڎ('Z9pNZ+0 ,mçUm2Xw =,M +h+,%e$=ϋ $&ؙ=ur}t 計I"EY{lD.YK**U`L9TGXy 2~`=,I3e3<`v{4XѮ$96Zɭz `yՏד}zyۥ;S'1gj7i?כq QRj6̂CW?C͐0!:pWF ˈc1nGӶw(Q?2a&l `w|r+h!~^BnMds!dޤzvP Wv: G 5 o'(.ErQ5:U"YIjdP[X:2rkʣ D0+kg8j%d癱ϡ%Niӌ,D]v4o멭uK[L^>* N 41{y O+%_u]imM7q Z H̱,LJV"QrӋ |z)cx ~HG-H`0ĆH _kjZ> _H.fSެ$}13CGhnJ:G!$**A^fXۊTO1Ja\b"aԻp ]%{2>s6B͸"J{:Row1z"*izL;Ւ: v0'>b`cLtg mC聓j ;ZMci64¿GҠ$r+9N:I1J-LmfRFAjc"0coΩ.a&,ܝ@78/ӣn49xhp}4 @p]N}Zq6ޣqw.)vto<:7'H4 Q{v }NTF U"_|Hb/\2PzU,}V9 _^i|bzn\!՘iJp$2 v}3;tDȔV!"#wih苕5D/n*' TM S΂R8jQ%,QGМUU}wZi\;< rLg._ke`:S7QU>yyWL'a,CFCGdVX"{ד Kڻgpj1o[oʲ+`$Q zKᵨWX_!00:0Fl"|x^'Wy7}hK endstream endobj 327 0 obj << /Subtype /Image /Length 19493 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 440 0 R /Width 334 /Height 250 /Type /XObject >> stream HW_Sa$\Gab0,TEJH]CfSl[]U$յ[-89rn}͹;~s~a 7lXVlmjZiGI.sJmVSũԺ\]i*[D' _xi5ЇR[\gnC <V9ַV'u_keB(ѧ+sZ1)Q_cRHXx"&SNPį5[)Mtm?\[` yVJk  >*F<Ԇ YW[`sf^Ӆ 9zo3lFm_N(JuǧIO4$]g]-eɅ6U6[|%?5OUJ~sy޼ͻ܉ئ !]jFf8yE GR,: f! ѧzSƘ6RK]4Ȯh$ F`H4޲'wG"QwTVD7NTZ MɪnHF5nF[_vs}]m 扁wvRž ےK +؆G@F(谐b1 Rl`[~{nٱOz)8o6Nr{>1/o.yEN@juZz$,D|d@p;<6XT~"bᚎOtw՞8>8VԽvu-/:r"٦MQ AȍXW'juDA``p8A``4EpQT( E fVz(jfB@1Q@B{j4kV6\VRT܆!n/&uo }{9煴`QMbG)bX.S_cU!oX?pz5&46Clɟnt#4Ex::b=3ى|/Lթ:OL(ٜZOԔ,IgKNJVr).]Ȏ6NDI1Rݺ#,#AG4$FV8=(h@Ӌs&/3XQw!tB U>2ݐy9`J려OG~iI/Έ__D,DB rѨY׾ZyC mDhrsk>@mP {YyNuL%'8tP*rmYZ4ba|eT09žSI'4cb!uLZ;xCO?뛻>ro,|pf*`˥ւ]=mEdq5P# hN|l(N)g8po'7U=gyansW뽮-3)ښ^v[|eM`!0NMAĆaFJܞ`)(lh2/DucO:jGpdGo9!] AL$8X/.rR\"HrJE> wP8x|<0swe95%Ã2ZHdZgkYS @(nx[LQx~WBa? i4 )S5̪Ù FuV5U,G2A~g$d`='뮞xOEu <~3ML4|1fY Iѡvy}  %+p۴% <g;=¾guw~34yK}!RD #I(l&Ļv`?kx !"ν2 M2ӊټ|Y_m"%`ttG8=8×GOzW'dB =2k O_ZHV)c28ߘ6/a^dNNK/$HsYL:|\m,Rzho[d8e`\ gg.#a}J.ϽYR"ojUpreb'NP㓧B{64kcS*Y.˩-k R`]$2#i789Bq7i&abNlsz6YjDEz֬#$׊f2 4ݬۺ$Oa箙y{z2hDUUE%=ھ\E(hJj}J#B4nK_D-$BэeP؄vH2:^0>[r|P"Qɺd{iN7;Mvbɚ:3 xbM $%vL81A48(XΓ0pvv2c/"tARms-E6&` ~A'o; d{˜`y} N! p$צ86sL`Z c]k"Wľ}Ln#H+LCuy8!M"R03,ڼ]7EQF(3˺2o7MR/ JL&™bt%b"[q@h?.]r Mc!B14ɺ^X kΏϏNAHM suf1pcfPMٻ#7JB޲C,hX6fͣ9 ah͖MQ躑Дo~TM?98?6׿B͋#in03狲aZ.7m*U&F9/5R),0<#@/Ϟ=!) oglSM(\Xpo8n7vX U`MAS4d4%/b?9R{xqi΁yo Sޭ*jPL,>U5y1laͥ۷[}}n idMX(tx-*ovnv8;O޼}z-Mlی?;``KCVn~]qSU6TzRtYHtmshPλռ;V++TJweWc \&`Y}|CMd!1dzP&T*-,Z*P<蔉NCݿ ~n]uYѣnKwWq\0!Ǫ&mdt4|Z4jUp]y}R7Q\ě]Q+Qn7V v}nQy5=ʌ9?~R:AZ67'ݼ u0U$9 ނK14\ 4_*; o)[-On6IӀE߬i^A6NB:fv!tFAR&>'ma/}9T6 EB]0_7P ~Sx&67.q/dչߔe-n.y¥3$M;.$*1زh|2Cb#ׅ EftSqe65W4,-^e={r#Mʲe#7p hDV@Bb&։0ej Ö0AIv%odIh f#=QVB[pPxֿv˃s fli\m 4 .!#|*ڔk,7!|T*_R7(hMA2DN FLul7(L36шP pM r$t*JKĉlgn.C O %B爐Zp;a7,pQ0lϱl˻.d%cxU"K ʓ)UMi,ĜtLHC@N[XcfZm6M 1!Ԍ~ g7jX2ԋsr~|.IylHM1*Ylx;.VD%@ {''C&i(Ex\(]1& tŐ #4=L'4nIyH7aB%}FP:D|uw8MD2^\2KwS<]^ <>kYix8^S dgSvp`}Ar,[f2V /UAFu"8Mr(B&HyԒYSH`!d}&B o_{C,ٛMB0GM&I2/M~Hf! s91N,粎fY" &y:$ly|pAi6YszgPz`:wq'g!$ 9>\jP=E6s:l.d-=/QNOf(#d,12iսEC ۄhNl3&7F{{=z_Gs-$'6t~#zδhoOT|n}#.z=a B-g!&k:;;::}y$X>X2:mdYEW{&ߜiOE)}蓓K4ghN.A5̡+yN/ēY7HZ2d!TBuvpiOJ9na&3WSY- )Z66FeQĤ4#5%H(ґ!H_9t Y(B8`Qrkŭ]w/s;M`vGΥov&nbw9^k iB3mdn'ZZnj٘*\t/J]s֚S17 YF>/hx8W̜:{nTabI$Q27 OEF"pͦ}%G'3ɒ)튭<)|]\忲BʛN`4sF&+R$GAp"Dzr`! 4'y` ,ZRU\`٥ 'Uu=l;Thjx .';Otڜ\N \=Dq,lޤg;?sW*q!m*y <)ҥjZk#QJkɝM ljZj_kjnllo_kV;LQTH¼5nHDav:0'6 Pe"Tsv]NJ&9iF8weĉ2> *. K^mdLM+$ !")Jtf'ndH"l6EQ?7Ļ НϽWS)g1l55JGMۑ>b)Fq6qcFL5 Hk!ڔ "Q$rxNI:dv:CԢ95L?t;]VR&4VhI;Yyb(HwX|\Hf/*˾ vʙIMKe>+gΜK@g_呎Wi?Ciעix􎏛)2 K[>r2` ,A2o`&ǣ2 a6MSfQB vo;u 7gWVY>e2I7<7H08OWVey^|#Q\д(/RFӾǪ'yx챺 97`|X8UE㸘E(*rɵ^'imҤIۋr 7FMJ" &}A=<,Hd33?{9JƖ~X{/V%})6-N BY"Pl XOYhS0a<=͛u u}g2SG{?ot7qb K_&d<0iy:=S1:{n}ށ45 %%SX pFi9zEaR5 - 24;thFc]/A=FGd1qp_#<\}!_ t_IfOO{%j<>tr5Hx֗M)R̓\dsH0UOI =BTfLo^X?_hxc<>2g*|7+Λ{wҬ1Ѿ<͘lPirj_RzDg[,5.L8 kE PuF_хԕ,26B*#MŒ 4Xƣ&#d. TH1Et76%2BmҤzJQ@<o O֛Ylx&+LkD*241كƈ"ST]󁪞qzoXK2WK^_DFul{jI*t3$"K:<5W, 4 .S4IR ~JL? %J*C .T Uk6c1m=$iRL=xzM̛@ӕcgq2be %N&QqIIkɅ\/q,LO$)Ȋ$yS(je4pT96Aa±N%-(鵨X9-v3t*3&IvC'3d/̖K.xÙb3)Tf-MFGpHAA(RE)՛YQz wBϢ,JlYDWD 'L DUrTH>M'1&hs(劮#:l bUP,/6}B}63z!`t$9 JQ 0Y ZjC7R\;ɴ9{HD"bsT Dԛ\.'LLIA'S;R.-"u s|lTq=ׄ+ΚɪXFP B.4OyCSr]ٿ(O^ŏ+.%$ %qGfKBm"LWbgo~w{Fj}sҥ?OʃZv4MTAm~2N\ėW]I&%1I~}+ tjA+$Mȅ$q_gÖdvĒ,5nu~dBS> iO.渼Є1QL@wFTw;s`"o6Jhݪ+Λe75~H񍓧]?apa }J4Rܐ.tN1=׺ ]kHs!N;jy#ŲyW&T0+(sZ5'N<}!{tڝ|,BK mm.q#N76At 'KdUtljK麂 $o%<rZL/5 lH%MqT I70 ㎬hZ2^#zzAP긨b(JMӑL}PڇhqQQ}PiڦmYi t 2մx{!6aͲd.D#t:%U Ӵlˆ50 d4U p"S(5YU S  T))njkI$fz`6\p y©dŌQ{ * E ?/Ge|oQHQh| R|W B#"T\G0{쨫 '8D≰ EsiXr\Ii- {((t.|IeKn*}Dl/4$ۡdGsd7Yvi3v<UHF/FJ{!'BzB(KLvMj%06m2WoS lM+*DvVک34mmAnXdnֶ CG!LA tm\JZ֢j0>m2ϾˏIٖ( x||w7KJ,CBHJ4 I orwڄQ$,e%9 k"rbDj摜,EVbDӿ"Q$N4:*65 ־\hPbОG4 D0 Nfi"ofo>7t&%#NALGz!bgC|RfSBhF.iSESE>~V<x>Q쌤plY{R(-rs;-9?}G$W}s ר"2 3j4z3Yh$re]<㟾is勯}xBa4B|{DQzxcYom[}.BvC@}/3/K{<F& MNȤoitmx8'+ LxLIVCAlp g8(/oYɛ*#*M01YN?0$QEvZ$̎ _w/UfZxiq<%y4@-pƟ((Ϣmv~@43B U[B7Ih>GucˋAs.Kͦ鹖)wV@k>.<!?M:9J Mh>Yh#f6WfyiZ)/UrR+UzfHm u\6\g$;B`jhՖjVJ *>jOެ[}P:γh`En6rF\5|NuMqSR5 1E7o@Tj\zi\-UYH{.ϛͶ8m݆om^|98{MqzH8Htnpį?ȉn q@l;VMˁ}$VMv -@DOXJsJXҾu]4I9BV8GG?33?y3J9 , LjR~gr8 (::],4c&'RGR;](dHf! "㧞8 aP.FlΩ]9İh s{e2Uu]ga<+Į `\pP "MBA68":m{kjJfk]ik imzNp6[tzBA/v(EK)1 Er 9@uTjP+tԥًhl«Wl BFfA}/q'䓷P,iu%&dUZlSIPJ.HNIwM~{iOЅrXiR6|T8 4R9j`r, H+4Q(j!`Uʝrn7Re?DSQ(ךL%EmH%M[ayD NI/<۬Б{8\ONJ 8e-Js/ GhM&''9h,伜Jc0Qp&E M'WcXSjy0x4=i&` k`#B:bV͉4O2~֔\5(RG6xT86:\bONwW `JuRIifmm,bQȺN?X|xyuI#O 4[8 4wu}HlsCg'-6ir OjjCe4#@b~u W 2htoƵЋh9oҤukAt\/AI 4/,:ЭLASt9 ۜ B%cvz1={KYBtOuB0lB(]lm_um~pFQshR9 mO"6=} ޷<} " ĞO;ߎjXM^Zmо6!oqs7 -?M#=-&S6! \Cx1ۄ|ym۝̎ݭfOE|,=:uң,X&qX4 h֙+}ѻJ5mI5ܹnHsjhelk/;w_lSqv5Q)v?_FhڦX?s|6N1lNEv7&n?^9Shtٱ(Eۤdtz8oj^\sM}.ʣtT '9Et8-,|Fv&U(D;߾@^nkIobWvl!E^7z| c[v_ 2ijf-B&{WorGb>\FEI{䏗vxaE=ovO,bsD"ncV-jjxNNLLOLLNNΘuW\T,7 k3itlhQ&YNHJz?Jh*J*irUe6oTEI&x|N. 14,ǥh"4\IT0(4gFV)a߿O e;jB>66l~;-IZ(ٻeCh@,&֘N7rF.QʐxpToW鈩aodd ֔RY@aZ ;]5f2$xLgɐجӍ|gt4𮭅0ެӧ4RrYEk|.gs٣Zr NGk<[/P! XP|lɢPӣi:3/۶u=0 'ؙGҥsI1GO-]cmAL̡0$NQb0N!~V9()Iڟv$]]^}=ԳkfGZùZ3}H0 uc`V-UM6U;&/j6 L#ML.KV)%>_NN?*ǧYoȸ1;>ЙW:PiI7e@* 0tIс6Ѓ&Ce>s;|9nQv3na7=ѷ$fwή$ݾ%Jr{o]tSLS,/Cʎ,xn B^HW*EP^TD%$bE$ԦFm{|7('Wr=w4upSZ+zƭ¤7KO{a# Ҡ{JL?/e2,|J&sk(QBMsF ncol>ei6{ mn!m/&hV JLyg\sM %4Qm9GE + fgi w@s4f! Y@' 7h{G< sLV)hj\'BZ]m{5:dta,A\ELu |gىo/2N| 3RZuEխq:-u%Oo|bgr'#IMr,WA쳲=>ƣ:|wqmgsJe sjYW.V@U&d"4/)'ҦKM oX$C}\k?-w8ul/?mda[ʤ+P9Z8b&3=ѓABEԱBys^Lv":{5drWsIs7hwZh e埞M 8jଦkTnrt:4eR 6\A=6! P>I-T~sRXT͙Q]#m~@VJ!4`N.Fz4c]Ҧ4)[@j9*y* isIQQĩc^ի*d![p,3g8OV/ir97[&ymaߛ7eiBP Ҷ0FH󂂚8=~JcwBC ]1% rė$fB, jUg|UJLW Qn04<TE+*Ҕ3}J `L 8aN Tc"aįM346e eTp82T8&;8+ݮ& 2(nы Қ*-8fi +ZFrt㮀UM%+2o_ fda>{@jRa\\0CJgD\ΰ K6ZMyv)xx6OjRĺ 6*4M6)NSg!ЦaH_0`a&?>/imfHbM-ӪK , L1 f, YL4w`}rQfp}_\uG%!N8͞ڄ9$hf]\wVuU7,ԠVi[ u})*o2!?kmf`KKl&&k59|4د$qJ>H,ZύN(ˑ𠜑0VOc#o:9Uy.I"X??66v>]]]_=/qQE^dBXQp J{(T(U/ʠfO,ݽ쭬w$񟰞73ɏ͗޼2d^?!,fz3~oxRDEN[;˓ߦ{4yQXsF.nl5?BoWvgjw*JJ ݆~%_@Mtu]' 1ݤMm`Jvn,rXBYmLRh|]Hf< ifCre٬WuzR6<\vg}O1$o50nFb R cB1xl~,m~:%Tȁʁ_=v_.οoCO/u::?9O8o8=|#- endstream endobj 328 0 obj << /Subtype /Image /Length 132 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 441 0 R /Width 26 /Height 24 /Type /XObject >> stream Hk׮ XEqZ|27-[,#M:8̺@-(zp؃p- ==pML 0! ;t jPXI {/h u8= endstream endobj 329 0 obj << /Subtype /Image /Length 136 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 441 0 R /Width 26 /Height 24 /Type /XObject >> stream HA 0E1gef{x#M6Бf }<9*uMؚ7ul!f͓:f1/[-|h8=dΌ3B=3ĴW"1$q#F>)= endstream endobj 330 0 obj << /Subtype /Image /Length 198 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 441 0 R /Width 26 /Height 24 /Type /XObject >> stream H! nnU6Rz$WPK891de1wQSf",*I9NĕTN"4R-,df+Qi/n۵ú:!; 6bkbT L#W 0Dn ^!qFw(E[> stream Hѻ e-``L /=P&Dq#]ttv)T@DkCbOWEkZ)vs}xm%MNj`i˘ByCT^RSXa>g\If2)A/PdM{@$TN-"ChKKbVg-5X+}`[8sA~C endstream endobj 332 0 obj << /Subtype /Image /Length 294 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 441 0 R /Width 26 /Height 24 /Type /XObject >> stream Hn@ ?yvLW /H\f34x&ZKKETO>ۧ?CV'Or;ךd,q8@)+q}Ɨ*RcckΧ7,rw 㠝|謥9KHӣ xU?;Z.ϟ6ApƀbMD/5[OmxCr )tu[H+d4bѬP`aYyFlf0, )le%,ƩEEE-U3g endstream endobj 333 0 obj << /Subtype /Image /Length 172 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 441 0 R /Width 26 /Height 20 /Type /XObject >> stream HK02lm;'N> stream H[!Ep,d'<4%F1+xo> stream HP0sa?`n&tzcWJC yQхm8T\JHh$0<}43$]='sH\33L8bǚ㛱d75CI\I-L>҇`R endstream endobj 336 0 obj << /Subtype /Image /Length 142 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 441 0 R /Width 26 /Height 20 /Type /XObject >> stream H0C; C&f0 ůu./.ca7?C9OT>JgΓlbV=,g'I*v$Q]> stream HW{Q'cuvfc;8v!iRH!AeYغR(qRj%$v+]!Ya]B+{eE%Yv܏߷>9߹'֭_~}B#KMmmM]mm]MfTV_$]%ĦfRI{xucUWpR.WF)ɭ[GtyTm}%Q6,zTo9B+J,[Zky *jZͷX( ښMK- .@ULi%'i?#nzJTe섎vA=ngiKÀX(PK-Gׯf>FF@ Zt̯6M `'%9B\5掆6cۢht[$ #hh{G[g(4#ۢ]@'Q>U E܄,0[4IҀlxuE_oٱqgOo_î[[#{v t v wbGoᆳ߈QRL&@P_&tGHL<g<, 0J3MXЁ=rG~a}oջo{i?'=1*)xPqdj7&ɌāHm&g!D2R16C|$HѷMG2xn۽ąئtӁTYV`"=^(]@/ޜeYRwi&GPLZBDCH Y(J#H5 a -uqW+ (TjCRb ^ K"BN=yt̮|2A ek/btaǷ  47z,KR(J! 5,J2d2,-|ݗR vr٩s~!9]fB>xE~]YY2B<ȑz-HSC0ubX:%2C5:\"q6iqO) i|Ǘ1 96f*;{'`!MA$s;b5H\8`6 7kRohLk{oچ9g/.=yyxy2?B[|R|WLѥ0O <do>I4%gj~z.5'̮,^[ s&%EM8>Aa wŤsSI4%qX"xр 5QڶG3wVA$⃑ 4 bJ$b&5%'33|_%t ggwwfKdh*knԲsi`P5yJ{¡H:M!ۏG<݋n{SgȆ]H"]^x[Fb"0" xo=hmza^~74wOJf>j%/O6 *+\3;uU~bm  $ȓ>"$&J^ XJ;ԢHp7VI(X QOfL(3vBLH؂)ܷSv4ٽʩ*#*"pчh ٰmnI# T*gʆT,$z+Ԑtg͟lfMI$ mfE+|lWho#>|I9-É^3rC*AKdah@ '[o=Ln5zPdWc˾"5hEgFLE*9&fC{{8t+,hX9.I;z 9:٠9ΗUyYvdo;rXz/ىɘ7`R.6&i@ @#jȈtͰˮ^85l[V^Rzbd7۝:WO̐!2Ci8ibNA4](bM'F3 GrrrM=^fMfC3 Z$ ( *=MNِ!-XQJhrf{<@f=4 QNMjC4*;=oqQ&F]P`&ї12ݴI/x r1S_V{Gvh& =2C3l@gHY$VlvrE') qS U͐4hңEisM]8JB6A(qOhN({ >F;١the]U! ݔaDQvK@U6MP 4Og97#e1 xGpf(! #sqqe2r 8RfqxS|EJpaԇ|+FҿM=7uFpjzgfÉ$)گ~F1,XΠ$ oE'S]>pVvJ6ЯB<  9cx4@2q"MƸLC`-TH7iv!K.!:Bfs oʲ` )d/_]rWbCdjb׆1X!Xr>D1BK%UHoT I ,MS&'FS`jW1;|%+XuiiF5n #!o)e^nM T | rHH$22i\'m$زBD?Yfun\%\ ) ]u(`bcl \mÆu|X '`g8|ѓpm9v X WZsp(Jq4Q)aiy;Ќ\.tm`KTwkm$'${!=݃B(qQn0 _9dHd/wMyd2aǚVӒG;W,M0~(h{ѦmJd/DQm) <x_AN\T|p(>lQJjR[,,`|;Cħ=»BBg:ǂƦET`سeQ2Rر_MQdWvڷoS=;ËTP _₵02fͧl֬L4XAPdt T@4[)egF$5;9t Tf4޾3;ܣpw08s3C{1"x| 5A!'u1*2="+1 I# NP 8 s:t`ù2?.͞йK8H24(1hiz0B=Iw;~Ds א^ =n?;(g.^˫ips/G@R*nW"n,vG/{K"⦘x% ?ri8zG=Kn{U ܼ?}`Hrf)&tLq8 Gu=NՍW5ߴt൚Hy5ʃH:!n\r-p'[N)תsg5gk9Yk_cʢfe7]_ye<ɱ l4B$])eGDz,-cu澁|sADBݪ;IsWUh.%~Qӆ@kֻU(f2(BLx#e Sdp²Rdk O)ng d'r(jPt[gR.}#Kq66~ːhr"Hd ý$ 4c,K\CmCBXa ~X8NfY/$ݒxKU: D3+yȕ g(Mr+4D XC67[ c3'NW@?@/*VU:Q )f>f%Ѷ;ÔdQ EJ97KAsL,˽-QGMS/hTBa(N<퉋gֻaBhF"vJ1PPRDTiDSjPfё瑣dd$9S^VT U eOx讌'B4B_ګ@P Մ13M (kǔ0^ȭB3E2þ|717U"99<ji'f*S*D#{ P TU9_1%:?/Gd2C E.qo`rtO(麓` ĝ$g <_JM|;r-B,Ӵl@R"*eRY8Y #_8VulKiY T,,b TT|G3l!=O|vm-K`pԒ>Ac!RbQ*Y( /9C3U(Oy|bpc-p)B1Ìxq|xJp ӄUD%ёW5\5D`-ERbn*2Xj¿DG(I>+ AM)vYN%St&5Nfɚ6ci)<̹G 7KseM;7hxy!Y7-[jS拕~UnB/~;Ė5셂&8'gsObء"ۮ_}cEg>/;724{>utZ_l\\oi8X[+O/6t@ Yu33W9H15RsdeVZ4\(ZPՅOʦD*n<|'wfqw9@;5G3˹yUBLH"W^jF43xVKu/-'& yf`8;vo7~ӉlQѴ}L!"<3;=*4shyXGkӛOZTC3͌ d*L  >!;5U{OwI565x-m0BQF!A/{I8)4r)Qz?PQʍWtMyY_I HC*N~ҩ(owKBzJemblC=q+rC+52*'uDRap !14Ib|r3]JZ$4+AM$+\N4׏ݭj6/ܚ8f6DS%ܽ*h#OޭyieC)*b MS FtRaͦ&蒯Ɖ/j0-B% PtR HFAkm#”WpfƖd,g;g -K/nniESJ?2ǥ$BUq@GHKJHF^CWxߙ,9ɖRhy<9@U`jr4w?] l<4@2-2,32MK:– prNfFY{ñ̺4+<2÷&Zb@+B8@4@,-Y^Ɲf4--/o Z s9‰̈Y u4/A*s OBA֛@Ljt$%TN%Ɉ@ͻ͑w!7[O/ߩ{۷6^OOGY!+LL2I:j4P6ETkř\({(i[Onތ)D\ʈ*#US8'qn^h4\a>}sk{м.$3ԹeJB +,}^ AtY?}u~UBJ$7gbمLۦ*Nt܄` "=t3P5_"sTM 'SD@ъЌBC/t ƃx!%a@N9\pv.Cn.ZC0Zþ_Ͼ*e[Ϣ& |/)Ça@-Թ;Yf7VZXœ*hKbーj ?J_ТMmtCV+yjZ+I $s;ىD=\_dANK. `,m'uBR؏p3IΤ<,BZb b>.e(e\yI:Ǟ>a4!5@U腨4ey"Nh8m2;4zs!5YrI MPz$,zȱ%v9ŠŭK{[^Ȁ|nw OeI|y֓k/&<!zH:ZӖ r3婴z$KD4ڡ=˔#(vH9M@jw]2^(0>țD2Sh1} tJ!I~p|MFpzRF v Ky{L2#s`nN TŁ`GGhj$mjBfPYKX( ՒrGD]sPh+yɛ~JVz';-~J@EB(z\;(, z -gẎwE$'xMgvvzGB T^Y Y??vLzJBn۩AE='@QL(=)J&*sSys`g4=#'V v:]R|D&ɢKCр8UXN& yw7B2WeyY^J䕁ȗ7w!vQN^~D4^_G8{hJh"M Mr,g,6FoNI-' ?vrjwnnn_y%{I鳛`U] ^'bC8xjT7Y/M 0~TƭF`櫹wG5Mhn]fT|L (!(fQEPYsh٘ۙ0%\}zЂ  )Yn !FWBM{Q*sifrz9x5r[Pι [P< P^]4bs4]xڷ'3'zcg6YrvvgI24|^?2Zh=A` n&}Ļ]yVrb d<>.4s3V2ӰY0UU7Opnα?"@}|z&ivo8N߂ 9q՟^ƀNG u9(rsg@R8a_mTh61(8I]Bs')?/VD>s7S4:XT^7O!d,  $(is(' (Y[4 H&QTtJx]')j#,RjCIs_w i(Rgx<3ͼ$ BfS4v>ݕ9+X8ǯL\DF"#H$v%p8"v /+*U<gZ?W/4bQ|ḘhdLSAB޾9ao)oݰ=O,.xIuFI)6M6š/AۜBI㎄H,'[\ yCBK Uq^Z*\T.[=vnuuQ8*IsnVEK^CK)VyL#Mޅrtay'ڳM{IG"\rl|,=ݝABMBgd7[_n2i֏@3&hd"*}} LѸPxMľ3mg5ReD(!ƒ 9:?65 x0vf@>/AT!{!6%w{,>/M^/M$qx9gE+eFtw`Cr.43s?yߓ~gƣd5P9[$CXv*B qCdO=A@q#(o$wJe58o g)V 9"g+=_=CVtw'HLl8\(Nt*rVB]>TPAbI,X}W+;_UJ-V88?@L^ً`]KGH\nt]8͌jZ9Ӊ<*HT5 >JVNeN5D*_=e!{w^(| ( b8NF{ ۹T#umtP*{Mѻӓs"J/dMIry 1<ϰ:,{ +.$QM HSl@@GeEۉBu!QdPWN#K Kzғ)R)MHbնBqgyEFuqzxܤf},m骥O89QddI!jp 9ERoh"psƺ{Ioq LX;cyhDMZjo4ޙ$hY,^;ɴ0M5p 7BuC?]yvi"󳃯=ē[/Y~%Mzyӝ?>uϡ))T6)UՒ/䆳b!X$R!!1EK &rbɩmx4ϋ(f0M).GgN^| ."i3C\} l M_5%hqrp}qYӰmKhٶ(i+֚n> kģO2ȥ ^j[Z9 6P ;Z>>ߵ=y-]XܐF[N.9NgGp:/߶3? @29,t/O?vHRiysNխ% `<2H8 G~bs~hꈲN^4!5ҏ_y{uv޽VAڽ{8F7<\ho?B4Kpt}khFK7鳅p7}/C7& 37<YGHwg^Ёn7M(>L u"?-L NZ^ʼnT*OɐL:Q+ٸ[MXY?obX7=_)I5+ؠWVnM\*T ᪈KUTZz›Z5j5+%ٵuz 4qU*$,#VT;h: ݷJL9QMv{M޾=y$0LLLޝb~*$ :$ZGFC@niDC!sN'50H"G}xS.w,XeB{#V3mFm*rkcE 57 Qb-el Q+1۵Gm%fm&vܢm#N5"'scDb q@qTijYلrQo:v!g]wM%A5ƵXErP[D4CPv<, s/UUf2W_p7g2Yc*d L2i|,ZBNuV^ wY_lIu9jqE1FŨы'צ:]gSj1W'.v_,i g tc\}bOviE{[6] {PۦElq*3D]z&E4@$ij&욠{om]@MR<{^oEAvw]+*[HM%M#gDH2|OJvwNXMBVxDEbM\vl{ ֬ĶSsʛrݷAa m~95&!q4N8$U)ə$b^+&RK{oP%D[ݽ;}R%[;;3CO\-{.FK! u{jpKdUBf.d2&WL4G_,4]gMݎllHԀ!R'^ֱ8w@󧕃2Q)kSgfpzZw;} m )b\ d>g*T^XLx^QRTݛNʕ/CФa?% O5X/4TEab5wR9?>_O~ɮoyKf ѹlCy~'8]h]I#vKSKw M{G6%QRY(__imtB(WōY.̇WyW]i>(H3oTMw 0MW[t-- Ι1) efP0ǣGއ2BqYE. ѐ04=rЄ\=INqv@3xcL\BgMsmBдhb4hvLpmϾXbl S,钮ZR颖Th%Bz,PkҾb; -OLM&'SI`IR)̒ӈM_&ԏ2KS@`L Df`yq+V5vҗm7oEHp6ߕSU-$GG;xBPB!OeΦ3fZZ0o4V\> endobj 339 0 obj << /XObject << /Im30 444 0 R /Im31 341 0 R /Im32 342 0 R /Im33 343 0 R /Im34 344 0 R /Im35 345 0 R /Im36 346 0 R /Im37 347 0 R /Im27 348 0 R /Im28 349 0 R /Im29 350 0 R >> /ColorSpace << /Cs6 1230 0 R /Cs25 452 0 R /Cs26 454 0 R /Cs27 455 0 R /Cs28 448 0 R /Cs29 449 0 R /Cs30 445 0 R /Cs31 446 0 R /Cs32 447 0 R /Cs33 453 0 R /Cs34 450 0 R /Cs35 451 0 R >> /Font << /TT2 459 0 R /TT4 1246 0 R /TT6 400 0 R /TT14 422 0 R >> /ProcSet [ /PDF /Text /ImageC /ImageI ] /ExtGState << /GS1 1251 0 R >> >> endobj 340 0 obj << /Length 7342 /Filter /FlateDecode >> stream HWKoϯ#`(ݾ9a$@ 3q76BAG7e{аX]]~#ae҅ V5Uľ[ݬ~6BU-BXZX*SN\VuU$7 yU!CyիZ)tB65'6QW~8+a\]Iuh-\QHH8ԕR8,`uzRוq)#! !s-ʊ5Dz!A5Z1C\b8.Nw}\+ ȢgR8"e=E𪄢b8g><T ^Ct/$\)t/BR6j?bʩaײR2S9yZ[9E/=$}d)¦f%;sWPKI皒ғJ*];WӑR1Li&4 \ On1SZjeS)+mFe4/ Ι4[H։lUg_Vg?݉#Z7T6w@󧧒mV9O @\C"m | l0Q9MAD}o留Sg9]v2Ӎ0]M#3&|Wl +&v$r'$'7-+yN)vd5Π!2n7v$%3wUP^ b1*K ˚l:pu1-w/yKQ*CxӈejW3tNPƫelK\ͶP83I6 4V l,Z;4NGW׍߳bſߐnm]{mwFsRwt4UdFpn*>q|bwO+R^^q[Jn-ǭV\TX#\~\&=gdp;kt͊i Fzuflrbi`dq1Jb`5K$Z/[˳t(J*!(||0ʷ.M|7!' /}?{w׭-k-*͢W"&;zfǛ- MjO۲ҋ!ƐŊJO-e=#6D"|"}ٯ} gIAc]]g aeaD>5o<Wb69\&lȉ?_?wأn;2ؘ-nҤ(qӬ~%TnنL=0.ry0Ie;c!OTgbQίK|gFXAp R Zc6r/ƏNU/ 4[L(/y֑ 5X:Ǘa0a!KpYX7S1?מ*6?-ljO2Y߽t73<G~E;pCpW32,/QxT8!NˏoK19Cf%dlD ~QGZ!Y@N$ UXQ)#CХS k:c(Au/./t)y~ ZSW؊h wMR:#Q@T~- Chwk!L {)\n/\ۋOJ=Z^ȿ1BSWt"ŮSت1IKM`,%ޯcC5$K??"x#"B) Srbqq]AV;:r^+$011 wLr !_)0S)hqq4?tt p c7qpӳGd|Qf3kgre 5I'#3+!7s#7q:o#FV mwW~ýl*(;; U qQ4?("0 Z$/ã%WbC OUۇn(BslDYVe6t{_w=n~C']}G^NuaⰮ;<[:9]ۊZn6bn)-ZuU%8R$y u?n9< 먤>%It0Ee.k$?$l'GǡH${-8`a4#6'\KhԶlC3TY K1I |P Y AqxHdzo{h|W3ec58YV}mXLvDc㦾Ӌg7ٯTk̖dn ˩sCG\0^dXyDUתW}Fw{Q9Ntsęp[{v&$ &U’"]q>l+`j >y[6s]&0T[2T PaCrun ỤJ"\o4&k]$\5dvbjbpm{͐:u4KJfj﹃ھ T{u@Su0up?OPt]p]+K1`)t_jWy!ֺߟC Kps~()pn=4}}ӄ ~=8s16ul]{4Mu?^3w|'Fz MaZs.->aPW>~G{)' GKYsx[C Sx^]wTǫUPz^qppJqhc|UFAfc4ĸw /+f@?:=U#~EmY||J-7AUT=O5w-$֥UVzD-x &$mD]*y PۈVhȔ.2ID1qؐg\wn?EgybprYgNfU޽lڋ^)^WgNJ ~bg)8xLwx6ڋ$ ^@$KϏTe]٢UٰJ¯ߨiv*FaZ&/ 4.pqU'+] Pg r%F> nGzK8? x6@!W"rM4^Q16f@|J| D܎/'++{,M[ǡyɆ-.ߠ,&7`%Bֹ+;|'H>G,LBwn2`Ţ4R"M<W2IiL&Mub6d K8P;^COgM&iHF:IdSl>B29d3F ĄMVVW]h5&1ծ$UCSsB">`٨Ӓ/=[[@2e˾z393.ѧP.B+,>ISz3dB99AR\zTMrb:kU$c|#ֵCntYm:eg30Ã]9j]leo<|18Skb#T t^^­^:v37raZyYC 87a&)$3zR%lR2z]+\GesUc%˗6Tx&@O2|J#Aeٔ~eɫPZe, |׭h9{o?pSLB;C6֚Cvɟۧ/޾2w,B50Nʿ)PH\xy~NÎ~8Lnva<<ˉgc 'pVbRfADΚidONOx>`,gDs0N--S>9LX|nV-cg@fܭԮØ G?Lo#>z]ZC}9H8.g.f ’mj#{ !g;[\?=k(|Y$)b"FS;'8KT\Ů߅.=6l._(X(Rcwݏ!^_s2.{\ Bȶ-9(Ƣ 4jE"YwY]Dro !@]l E> stream Hb`d"02 88X9<|$)'I r!a^L$B6 *W`P.U:' vӁ54utSofi:4253v!c&aNBpZÝ8"4Cc傖$&N+Ak1=# En:! endstream endobj 342 0 obj << /Subtype /Image /Length 155 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 445 0 R /Width 46 /Height 22 /Type /XObject >> stream Hb`d"02 88yx|j~AT ZDPPTLO@R2ĨaWPTR&FIfcSOyI 0 !sj"j X MLLLM p`|3s.|? endstream endobj 343 0 obj << /Subtype /Image /Length 457 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 446 0 R /Width 95 /Height 22 /Type /XObject >> stream H[Pp1oN+ٰLa+jjD{l h҂H\Jy+<9D)X4,=@s$$d ͍Pysiyj?y>1ypPx{:c3sWry}"LݩW_Z(/HCx7^X4Sl*;2TޭYje/o-TV?攪G6E{ȼy^9OX^~ B8'ܹ[pgs:uuA> k">{' ou@2{oXt>=+5,o5,4Wjb%/BySΧC7h6#3a endstream endobj 344 0 obj << /Subtype /Image /Length 311 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 447 0 R /Width 47 /Height 22 /Type /XObject >> stream Hb`d"02#4"ˉy$'r^6ATOM ; d rq pIJI+(6SQIYCUM]CSKrNm]=}CaM# "  r[XZV.fmckgg`L@9P97! y}}lЕUdpDhX,dc΋\\Xy'$&x̒SRR]xLbb`ATě%rz@JȰD; $ɣb0H0_KVT endstream endobj 345 0 obj << /Subtype /Image /Length 324 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 453 0 R /Width 47 /Height 22 /Type /XObject >> stream HiS0@E4i I -" *XE("//P;; 3웝f$0@pl@'+ 0@D9XuDl nGYAI!O$&cSIIN)>C(=fs_]}/,.Z=uXZ[SHV{}Pdpգq])dX=5Zpv~yꤕNW7]ч<!Ovꄀj&wt"v{^t`oY@9K'檊"ٍڌZ~-+)ģ_}>#ird`[ ?_V5 endstream endobj 346 0 obj << /Subtype /Image /Length 263 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 450 0 R /Width 46 /Height 22 /Type /XObject >> stream HN1Fv݅eQ) "^PA("Dmpdq=X^U){:fPC$$m{iؖeEjQ[3KT endstream endobj 347 0 obj << /Subtype /Image /Length 270 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 451 0 R /Width 47 /Height 22 /Type /XObject >> stream HiS0E9 (QN vÐ}fg],D $5X 4rPuf*W$o0aYI2OGJuDtum=]ldl.@:q [EDn)_TvZ=Q?(Gq͓H'g˫N~:cu{  B}<SB|Ô×` қFt߄<֮I?%p g5| 0M endstream endobj 348 0 obj << /Subtype /Image /Length 19549 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 452 0 R /Width 334 /Height 250 /Type /XObject >> stream HW_?k-I$Pb⑄ AQF$WbQi{pk"UդWywn 2;f7_ޛ{6m޴ys͖m7Luuz3jW{1TWgXdSdǏLkJeƮή4 ) 'B?#S6zD䅑AkW:[*I)巶UOcN$| Do#Hy4J('+fKl,%RSu%%⎮.P`כBF '[Hh˯ITЯNhҞ* fC A:>ѐCϫZ*FVJ؉8& 7&"尗 I)[5#ƀD`""5Jq=IH+7og, n  G"@8 BÑpGgp(Bjfil6oP_Y WSM3J;K\I n)gHz8Cz: udgcOSsQSi~/׺+*W[g!."OĩDwwN;~S>0V&m-x2_張8tl>z':2]4)7#cT.7ɲog.|zۡs^zj`_l=}'~ymWW;Ǖhʍ>ڑjqJ9rT*Q.dsq8v$8b 7&-n͐`wP1ϡ踷D͉[Dщޫtt]SEǾʌ ktM4+/-̉g%[\Y̒mh o?AYȉIr4p)NLw|,f`y "vC[^JIb,Ǭ:UEZ:q1QC2t/X%> !  -H˹zdt)+eEslHcV7. Ic?'Q\|sXt1l᫶=MׯnuWx魆M3gLJ)[K4EAoQӀχM ˻ᾰwopi|KcSm=}CSb" R8.N%bX0 "}e·, 3/^`33lf tיªXZ׉vTb, &B4{6xJPq:c 9L-\4CJB pzu&һ^1YPrrYf*dV󧼳tL&& gvBAyY푗P" o9[p2Lr|^9|hxU7=͗h|sB#0'!YTAzoH, BN?mpˋ;=47=? K[g(^A4譐ZBXZ#M&DَistK}v Ϳ VxƹT4w8929Pb^zSTK~}$B +Ɉ%[`Y))#" E:1D%i* r<poZ͢YUDy/nZecjlሠש#G.H侅H2)c>}gr%'dasB>}߾nrؤb+RY~2ݜo1KDgRo ߜ+z4!.d7DgUJnVO-<[ȁ]t1BJxLqQ_ . ;I$^%NidibR4%MF `33(giqLb@с-rD)g4Vwf?u7cKh^ׯy{?~%e ဃ"*ipCdBw%#|N"B"!pDC+B@D."RGdD,x[2q'?{%̽{[2 0eMj\1>ԋ NJEkF9!hL^ 0 gJiĚϟO!(n`uaCB2`rL0b`H ߮C4`D!-}kY<=577X_ h(8U%bp\|v:"Jx&P6sR5p}վ!.sưBrizsّÝ_ë54UMta֕߯ I( ݎ@˹e|pmR?9KwN$ wͫŚWB\;_CjI걈r?} :84 o()VVl֮lll.krSnhhgO Cg񛊪}_pJ_e$:*l[[~kMy7JgOJպ< J7_֮4~q{Z~x|5oSսn,?Nw?N']fWD z-OWa'*g]ڢɻ"B7\.5(˶75U@~嶢[ֺ;Ys H#go7e0W ׼ @med+5U2\ϞChtAN14sdJ1`Rez ~*@ PwF $SA x!nRQ%"1< 6 X:N ,T>vD~q}dAHdЌ|S7:Z4Z5wF )3p ?Ii04 L=|̅ӑ%HV""C2ޘG7EP&bB%$ds!ՊY1p(V 9#2X@nra*o9DƱyBX9BL&t|bqKb_xq#(Ib{^X2TXGq PI2{*ʙv]x#XԐVMF %R_'&oKg.j3xJ,>5//5ƏgK_it×&sh8qJD'-6E?Ѵ(LC K_V Мe7|a˓cG]׎q7MVum-]3'2X)8 QwW;k!32pעk': 6rin?= A4Oմ|!:&I孃q_OQdWʤ``)Ubk|A(xu͢[nq}6;H9A~aE6q&ʖUC0 6ܾ}1 lU}-Y_6UgOoZ?nAonܼu3qf$ Tnom-xJTuwͦs;uW6^+꽠mRV+eOTԭ\-fƹI\W'eUQT'PkWߥ;̝!!]`hq0;oFлE7JVW.^>~~~>&V#HhSC^V9(Im "QM0 oa*dG?^Fޗ{|?bP:6N\)y'" x@;dL&>M@',L$5Np[ 7kytgE@ȧ{;n- R8fTJQZGM~iIдnoo}7/f;GVUsr4ce757߾h,^47zJUAIA2#$%X,k%@S2H;*4=4[@_DŽnRwJ a^.aN'pFnd- k<6k~<<.w員@3R X'Q `'Hp'HI͜ܝ!Mߝ- "EF=гnhq7ZrH!ǬnqB1 %ݠCѴTH;U#afƼfiżn:;Kk/@xv;> \n=d[u[(Wם,iNƶo(vchfN@nnR  (7lnՠBn:tNmhf4IE X=l|>$0r2V@IhX$꩐5ʔQ㠒(-#T!EC a\^W$ATE/7n{BZl{7dsYRC"12fVGM4E<.<}Tаn=,4Rz:30Shah2~2\+Veﺂ %ULW`snDywu5@xɚ7 2C"3>  I  m!ˣi׳_;ߝ|׾g>jezε8beÓ+Nݬ_k?;VTwN{v_lGI\|*)]knqs]^o©hr#_>>ٜVʪs;{fa/D,4X\L[Hj5>z ;Wk[u$.T]PAnY7(hD'?{q}__!>]7=m98Z7g:F!raeHA^Hzq6Цkyg{JZ_\)_ - __/<3h*m6jojTuV"'n`%ŀ.?ڸ[oV_nYs^Z_s=t>|S\:{K,pW&̪B;*'j"=u &9ǫJ7v7DcK7UkhIunRʊtw}CwT`8+Ǣt:f^]8˽]rx%3Z8 qT7rsdڈL*|."guYvsE&#iDMijKy(̝ѩ`5/ƅ8h:¨` nb}I&駦 RJa .twvN*gi I2dX#]#@>hYj (Q֔6lP"El릵xM[ڬQpCA-Jh,EBɐܚoffO^#Z=D}cdwq!^8V#kD^[ñېȞ:ƴȐW!DN4f+4B5$xJ4;((Qm[h&ޚB]ne_~^6YAӭ6|ӽ"]KC*J`Y I57Ej^Mjj ޙֻD,ge] k Ǟ<2ьX{!7 rB!C$ENU^8R KjhAD}M3}nŠKiw[ܴB~ sE:B&1T-$J^d2i{7#hazp!,B!Ґ~>iDL"TI4ͻ0"dƢ?˿wHOƟ8653lpY\?i;PWWw+̗D‘H$߸(ң|<.^4` G5o>dM*Q{!H9Xhqdh}8CY|RtâǓe&*:ɽ81ǩrkoh&?a0QW[S~s<ݻV4ӃchHcAJrF˪@9/ eST$q(0/s{ڻ/3 T*Yݳ{7ZZ mH; Qu&ÃLL `.G*G*cYj"Ĝ7+U98 Wy^m_T}\}RVD|45YyEmjd?`4(-f^0\î@Uh pZVcQ$OTTTlyP=Uw\]aX` ef1V=Z?7cSuM߾|:e{`d4&wm_7 HLD 䥑@(12ֺB4{tʣnDokjϭ7 D]ͫ_N a-u{||y|ʣtLH[s]ltK^N͕KBBRItDb2(! q*фh!Yp~}}G|D~vqjͼyf1?Ö_YZz?f#V%W/ތE||4|PXj\[JyI[ %8\#BoС /KT P)?Z@mS4M/*$8)IqGD$-rH2|h[O prng'w n,~:C8: 4ׇ-?$$o{o/o_PwF3t"b 6`9i!2ADhFst:҅`8I)LN;xm^0˕x(]Ϣ鈦vݟrT 01"$g1ˬ-D3b(Z Fǽy\ڃ" $nB(QZ@*1Gxz AUB<^#7Md'6EɄY &MzGB*O([>Mޏ˺{ &8 }D({?v# i`O 1XT^z%ڍgHna-D{P 2$3iہGMa]PA fPEP0P-4$384&눩nO [PG:hr\PNƐ)~8+Sxx:IXJ}>Lӣ(a ҝk-4!n,z>lǮ6[Ӆ UIdN]cۉaBiupѴW޶ Y{]J( fÐx0*ё{ʄ BuBk"S A͙hJH?%T SXYPeju~njGf eNk\Ől6MבPU@RULATBl6;FdN>YV,xeKv߮h &clh41isnK4@URB4=S"eHmh:.9K z \*)azF*k!'lLGnonn⯔0c6fZ`'~kGs2U(ho^x}=:dW̬<)COr3V&y:1o?S9sxՖrs6\;{u2Q ^$v*ɏ5K?ulaxӆBpʢ,fוC.XSBn'- ?-(gpfzK{1 TfYZ( Qű·o_O;W=okbLSe pF`3+ʺ1LSgW-T48­dYtR?fQērRPUN]W.GpAYF析z*8"(kje,˂iA"@\M"Fson{z–$R!50M+e2)e 0LfP_ڃPL4 %lAQw"A `j"p) )ZX}6>qs ɹ'6#N&4 uZZ< WE"GzOۉGRA)(= ðSNƚkB\:Υs9%KSAhf>thRtx>z{Rc.y<J"5m )'qAN.NMa0<1xwPw=Bn"A)lqvpO:2&)]6**^HUusA;kԙ%f*ȍ~`p1nݮv6EZO L#gx ؖb26; n r2;uLEn~N=gH6-힙9zxy^$K$}O@HﻹǎJg.`8""Gg:!9yVBa6 sB@LE~t#!?q =kX/E/`jZR$Nt⠉z>M.yKWhαl28 V;؀ (PRqG $rSAVR/!;%\VDSjһSdn!ILHLsV6N#}_? +G T='&xHlŅMp!3f ܅](] bB3T"8I.D`]Ȳw#6 RK̀TbԤRpT99;)*M)7|A_߳']n.rApD, tW]=owqsC8`g^z8ϻ5=fNG{rg㗰/uY&,ɂHLTzB<#%n٩Lgy}|9H*GHLJ d`4Cu V̽qsK.ĭ%HISꅞznNɉ򲩕BBf![,'ENMBs55 jF9Ic"o>cdΰL$dBhfќ\K\HA:Pv'p1*&v( &9ӹm̡ q|3BA"%:/ b܅:s3/N(OH>JpL癲Y]2Ry>Jg.$)Ҧ΂fN 3/3$QpC4/+<#搌I7 9$#_oMX(c۶;bpɃ$'dÚ9EMjN psrFG?rޚ-=YR;dQWJn: uST, n@%(q$$[: +O^Fv% 9"*M۔:o+ UGr|y;wN:'usbvx/T6\ѯnhN~aZ.H}:̢yrSI^ m̠ G̍;6 e^hWcl&h2Z0@ߑY8B8,7%Uv2ʾUs3m8A yGXA '44/.Q3gfocެE 7Α wOmtk։'Y4AA腀(w%)Óq.-rQ7}{^rWz-80 !ZTP)"A%͍l/4. 9~g߹x?c;;g_:)M,̅8Emx@Ta='D&]ӑe(PA)93⽣_[k{ݛyn7'| ߓu⁢(,U:~nÏvy/$'g%~D qte/ wv&ke6٦]g+6ڮnumK2{J7X~f/Dc((0 J) 5LI0RLv=~U:xwzo`7~z (QNSV̅cB,!(t>@~R4)IsM8͒[錛B'',P@9EhJ,ߟIF3P#[1ъMI%R:%y@P]:`\^ L/#G9Lhx'Ex`ĕ0 NaZH<2EIRg4Q uSo|]eBZxebu#Γ`I\K+cw 3l!`l'ɤv“Ӈ9S2Mȡ~s;Yq#j^zQ*q/ qfbdžePz!51!!.2ad;4EXyA iPa8A{^ օr Uu˪/kV֨ԛfaJ=# "B&Bw/Yn:>U^Uj0k;V{bta)z: ]/S=;~czv'إtI(K.繹HVh40UV7ܫ}J(GW]=׃/69b x@\3lZqɜlϻJ~5AOV֝apڭy8=A\ ƂmU*~`ߍ[++u~VNuu_R$P.Ԏo<0ɡ9aٴj ldٿ1ڤiԖByS(OCh.|iYҶܬR Zj&l?|Y\mm4WO0 ah Y K<>y컧Ā|g.s! ըjcTqn^7>ZnWN]ʅ(=B,}tțC}]ra* ;05_?tq tAЬ=]W%M$Ud#_Wm`Xkft:05nl`j/~SH{!Do_3*\p}sait Q74L4?{PѤ|hNI+qgm (0z+pb$\^\Fvq"3Lp@L6f! d4/i%!؄F U= $g[!׹l < WK,Œ쪡} b&l"ԠΏMj q3'OۊJ<9/_^K!+=G4M\;`θ#, NsX{95Q hA: | uk쿙=ty;\53,M\vTHv@gI^2\c4 3-f!+Y Wnnߞ 霻|v{^n_}aH>|2ҳP> -XA4_6wV+7f&jJ5Y4)H5m@n1aRŒEPNbhaTlR-TqO h8z&J=ћɶlz)eqθY=U"12?Cރ. 앭)z nd_F0҃ YmjJibd5 (865lĈ`;  ġZDSH,E6 cؙ6B"i?fe#߽ON_a@tQ>|^O^,mqqY(1{iNCXX8,F.WK+$ !uCbfQa-iY]baBjLWH> tX!p^ˇh/: 4ɟ#D %f2tPPںeM ԏu>A?G`Z>HreK'WqBe,5W9](ynUa:6v'i1k8 @`dZ@^_dɺeAQnYt:rF77s=8wǯ}JZA;jԺNFޒ67]OgS=pW}~X*>UP7}ӌW[dhǚ's-땢X(J)-VӒ(EURQQdUPGwqn^8xg n\3Ժ(Ӻ1O1[2ZhnSɥh6m"2jM;,>fs)ǧ0M )B-4cqJp X G@.Io/r#=߅d2*6OTL_ȶm | Qi7g+THnuDAE|9/NQh^SD'rq+D@Cz ߜ!%ZȬߝL;?Ⅳ BLsKvolBeSDI$$+bC$rjd7K nߥ Y;}%fFJC箝|.:8]\FZ*auc0 rF0Jȕ0"v}+:yҼѦ1[ƯM3JbӏO{3mQr|sq ?{'d!㘓iqBI,;$s $2:'󚦕˞3Wn~:ouT[kejunl+}}44󋽤e7%.|$m4NZĪ*aƝR *'4TUi\rutd_a94rh'䕽eCS>'fGQϵE;޲k!!Lmg:"?Xr_ȧrjU=-[n)4#$D>_4ܫJ ^["YHH/THcj'V |oJu"X72ZB͵СtZ(Plsْ$ ɹ"1 ZP범T1y{ڴv]mO$^Q?р:]f 5&tdL j)@JBL*Jv(>׮Z19N{-m'[mֹ)&=Ʋdf{zfΒI//:4!@U1FI 3d.z]ۣ$7iJS2ԱtoRkЄHM hI$HNIA:z)&{~)H:fM'ܛž tQ! I1D|d{}[o&цȝchv:bE{D E-rf`"*bժ>{c$ M &E(3*CDO-W"uM z c &f2:ݿO]wߛzNH,BTViUR5_]p_ᅜ$ MdONo_g-DTQ ۈ>iSsLM?ݟ1p!,Jg.;fL=kufW޻Z4,D"E/՟/EӴ:;4צcmivZ`0Ѵf+ێX+䏟vEӼ ú47~}q.L ׮3ԋF׶k{Omۈ %YHpު}=Ǘ&BxA@#{Fl|Qz4MKZh.6Z/Q]Fi,p%^P7َЉg՝٣" ۍ,B(|>f#lCH~α}GǙȧIԛzD<4)|nqۋ1z0ƭzLơY(Kw˔Ӫ' MMWo("һY D*$4BqmoUxAeqYUIWҺ:DzVizŻn 4@TPrH7ܽkZ'tؗΤI ' rpeOjF^zk7 M-˶)tq<`&m%OҶF+fhEXTUEj7C45ބ,E<:&b7G mPc`0ek2 ԛ[E[ș!n68efz2')r*s6M-%$Z+ ~ 儚[xzA6['ڛfe`5?҇i7Az2cJgtt_mQ|d+Si9ꆄh1C S@%,l2h(J#U$,i]޽;Kw8v߽{wNFvތsXyM6[' qX]Pgh[Zxizqz5;$y^ _|,oѷa @}a 3=SPw&b~]̟#ý֖|YDLaRrlgCAuѻBb:'㴜D*fq9htA@Rj̨2U+F*j`,UHɚZgt%ޅNV::$OR ? XĹ͜MxM0Lĵi$&c(ל%ŝ Υ3r.p$h{鸌1DW =HRKVzD 𒆵XzeQ5+j2] RtO8Ke*)E5-_5j.ܚ8j79;>< 08q endstream endobj 349 0 obj << /Subtype /Image /Length 22003 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 454 0 R /Width 334 /Height 250 /Type /XObject >> stream HWCU$ɮ%/G@pJ% JPƃEzam+K9' zr_֙<6e_ٙ|统|=pࡃePȑe}_}4hz%crcrBxJtx콄oBp$#W~*FDt8}B v\n%',HlcH|CqO+䨵Z܄J˩4<:d*fcR̜gj7 N"֘f3KOLZ2C&~ӧnƃ&!1"3\Y"ݶYbb-:N#Ai1Ht7 T/Fv Ot`S,xcEJ22@$Ƶl`M,n⒤9`o`#c9+{ٗ#E2v@2e*B;*BX-Ԩ鮰ɐ :."~fޅ #P,3p hXbR[W_nnq9]tf-ֶv듓S?8]'Nry7X\)0T!` $Bz|}?,ԑB~W[]QOj6:OYΜ=Ӷ~v u3%O=Wu<~KSw3DnD,t]2 2 S=#8<6MB=zzTWqZg.\s7UqڻJt]j:zrcuOˑN @{)H+3/yigȎ9PP0i{hPT#Hnd!JIGqgR˚ Wx5n*! M~Z6ږ_}#mu{ ͤ/hYB7$ NȐ@"}ÁE3=s CY(٬6ZAX"ʵ 0XV(6~43I"VEܑtXYd@@5{NP0%"h6@7izk [:rVU$^m=|IS'Y`GYH6' n~u׿)3){zn[h>dw49 )\;-fZ𺓮N6HQ0 ~TO2lqB[ȸ|/ $M$ތ=ٽPR=)x41RFي?Rm%_MWVޒ } iieo/pZ  ,݅,!+\N!FUڔ=gdf?&y]MꤙT`R#8  '.9;q0XٍfbpUvrsXϖQVRmLyHPXK,-XQg54m:=7#E,RBwwgmacVOx+eR+wŚ6o#W3wSBR3|#1wianU\zNW8:kZ+=_8}!I$T U ,H47o3.VgkNg~7\_qζQbkނG^K~14~M#MӊovedgZunRXǦZMLHL(HPؓLnR4Mo!lӬh+휶EW  gk/ U'&+ކpxUx.w[* yEy<`{W6<_R1, ߌ qQ YA/ ^u}BaNaӑ$:k+ܛBP zi11H <6K %_u69L~[}M1Yw;ˎNe֡FHwCNo(s$iht!unRWܻl!جgdm($@[9\D$3$KM?"U':ߓ75Z5iIKP",i!H JI&FMޥd\o2MӶQYflp98dM㊌'wahVO! |i<+v<_4%QCA0=W qMp{߸]~~MԞqBG[SUUu].$pŢhvtpIY0V>ԟ[ڞsWZTs3 8MZ/MOLO=| Ŷjfl6sM*hF|3yuRRrrrRrR=B4i=bތK'JK*"Vlom=uMJ?JS0m."SEK,Q0K eف_>g|~8e8nL4wuQLz%""MQ>?FvV]ellAxYc@R<6 IvL7[Z)jfIɎMC1*$@!b(i06!!&RЦTz?xtA[3;w޹?9~y'~~}Gʅ8G-'6}z翭X>{0vJ^_/H 6Yk q8_ M/>p9~fʡ+V e頦BE3Vo:miHV%QUAad;ƩS9^‚[JeDTYRdU2 UQ#|>?*$d]ߌ.FXSŗ'QfA8)n}'(V.ߜrěe ^DS hhR5J^ }2J@-xy 5 A!,Peݾh'Ӭ`=NUzOvBS2hB'F^JHN<*L_yAwcLמ?"TFvBNU!zƚ (#.D"`+_YYČ+yO4fɩƊVk­>bc脕$uwZ}*V!4'M_.">It&WZ7msX;su NpB#΃ћdtp:Э~G:YU׵HQl ɏ1^pe5}OpJX1KǞ^4ded̠ZBeLW)%c]K$ܡ /d٤bSSʉ#=G쇛ӳMt34  F4bs8o|08(zDi~ 4(jmk ]ZqwKTûzOƕ N\%S͍ىƯ$nbh)a`!aܨi0|~#b$p2,9$O T42mZUk"ـ%x(*Wcd[G?/^ﮇ`;\ gSj!8רЭK&xRvk_62SjM`i}S<NJmwgt;rbu&=c22NC,+V_d~`-c$,nLik>C1892Vt]hhdi,o~wtZk*lL%k9y8O .'$c阇&s➚2ss0 `FTg ꓍~&jh154QïlkztѾY6$Y,O}sM-`Ę֎zwcL[KTdܒI☘/(+׾ab@v`AWE$e*l^d+A:H@mpRAlV*"0"<$=5 3mϝ;g|ϡC4&(=!=9>o1)8iYf> ,dX둣ׅI$ MPԣhD==V[Rtm$35;͔?d}ⷋ!\֤h9G!9N02# dk']u.$%,xpKQ$5f .4Z2=4 >&v%b)LOKMt*f$1+BSmGәhrZwwwn7LWTn0aj8e&Q.L׏hYh2\q!鉥 ΢萨t?;r;X{La嚧3OqFXKOgwлKSljg] =єmׅ6JPYV,T}kLJg Rlי9e9N]ș(.AYuYϱڶAq?mv"9%&͕a q,1V0dL)U,dg;(M6'sF_?9<,;KfdCisz: $ڂ"I*\,'\T\|b49?}Ul:v}͒Zx~h@S&% Wծnf̬f|U_Jk%iy/^ϯJi{{fC Mô,2'Ԓ$#) # 8i km> K@5 4*yuQ!6 YV\(-hwwތB(LN t]ЦaM-ʜ.+ \|21\mI[LH{!QD}9{*MDžϡ, HJE,j%4*jNGmadJrqxyw3u[RڐfMsvy+ddUIUH1==N;;\=7oݷc}od:+F~5m_RZ7Ĺ|2t ugدCUe?蕆OZ0J]h zjL&A)lIك)2}ԱQhOgt5嗿u񓗱+B`F~77 儮4Cm1:;%%h>SmB(vڗ@#PۅFT!eTeIBFYBTIt46=.g!Em{|=kl.&d-VeVkZ#cdu~'^bf@BC 6psw6#ױn˄Ksgkxmta)pa , ҥqh[ SVtd%(|b2 }d*%I6shVlb =v.ei̳c U5%]iSikn^IuͣK&WFI~ 4[<4C]D͆f9xqie=WJ^8z,L>ZMT7R&'*%,kMGEEYZM' Ԁ{55nLMH u0:Q*!F, *U"nBg wKtxh]4$m.A`СҦeӖMLaPjMPO/g!}߄!>RJH.TUqvMF pbЧ(Q38鑀c4(NhAPAї'="ekbWwtJI- UE\cuU.1v#i?PE2~ 5d0"~֨#%`^!^uKi1Q/z.g̞SU}i9O?ѤhT%pZCG3!Ϭ!&6S9|E`N3αkw gm2#O:ҜZu8RӞJTlCREzwfM~ o# ;3t4l {_9;\YMc[mºѓY/b;ƿU I  *B= q;2N8nJQ=M?4V"k"d }Bť jIԔ$-!uMI4B^ ]V*AC.!ϱi2u]JyQP4hBL=SLMPvYfk#@5fy!k'nC:Ҭ0!ΟWr9i#crӳl*M+/020 sCrZ[]#y489"R4U"s4=/U;l,K9SaKKtBQI4Ry4a׆MDy4Y24&B[B*&s0D X(TN;٩ Q4 SASX~//']3$J$&&!NBs/RAŵhQ!4nnW!LLslęN1!U_3&A 8ztv>3^SZ1 a4v>4G#J<*ދP j3 ݐVdzNUɞděL{wފᦲ٭:.;W?Zf9{_Msehl?&PG^) 2w`d3n>0i$NR41 'cOh~{~nIVt?eթLG9ӓwKq EH8INKFWzn4_RP߻͓.e=hޒqr,MBZah^<}+hb1E)IGdP${ ܬ&OOӱ7D(/}H}tDÍ& Vibl_oiJ\%-PkrD"s(pGة,* }&$ȥB 9k\*d@?OuGQ-ސ͛St1w9$ađI4rh"%X^J3^1J7 oЮ&&sBLKL_qN 5(aF|^qwVX*D(B$@e+PS!$mxj8Azpp4g ss:j 𰿯+WIUg:A sXw`y"+`nNQ,/d Ut[,bڙϣgfb׶ϖ<lN4/4/խ MH>k.}-ML:HVybo1&W5ov[S'g@WY:գ.0繪jc'XdJ"n9ICٔm×8iKjTęO^=rJW?75Uɹ<7!!-D '*vK&'(7o"A%Q@($'&]SǏ~\i}-tZ%_S[.\jqSj :g-DҦ S QZ2LI01K+8[]  C%R>I2hiCIة1^DCCC!J8GssжMIv djRn]z#MNLg LU^zu&1Nk'2IvN4V "EDiY4EnipΎTgVqm8z9yS!Ĉ8 :pB3=_sCi䢏}K?p#n,=fh fPY0 *~~sI ͍ͬ<7Ź8^orɞmgNԱN2La@ G^|NrDpIltijɣXvMĠ.dőى/Bf#Q c +C{#4w*L[C'CgcL?_8^۸ [Ooӆ 6>MS{Ͼ'̀$\ WawBىp$~È'_Ɗgtxĩӛ~[ņwh_$\)dsO fe)@CQ$ 0qřzogݒhTRcTh4 t +h%ApaiD vL4`7EhK{5\}1((&1 /k0!,U^x]H(Y0 \j%( =&%ݣ utzNHBD^f ]ZizƯ]tf %qO@pd\(GphF#14hSr+"i1I~(だD8N@-IZ8Lý]?:"AҹHK_L[.OGkP.m()o*2RcS ˎi"aD)E1AatD G}SyMT7r EY./6"~M׵7xYu;|$*4(>coHIDQ(z>3zW7*,{ӥ*΀RZ[~b46Yĵ??1uLyT˜M#{<%r,>o2.% ˖@ӫ/g6ϳUnuy^[yxoͫCuN&Q!N84}$M2vy{|3B)4CrbwNk|,Nz粦H~a|XXj\ڼ vEӎe)ߏ(VbtmQɞ\ ̔D#jR1E!dJ Kls wt_emO9RLj߁d9- E<#Ns΋)7 ,A;cQD0IDd, YibY$a^4(*pҦ=]Q趩`W8 ;u@d)q]BBCO%`豲4ؿIIbVΘO.螎-6^ۢ_WiBY=z";;9./9_;;PR}8)IDS'*avdRV.B$! gu7o|%{[OU< _? fyjDHxpv2bEU$sP6VMK4C,ǀ&-%'.'vf a䢧DoB.Ԁ}D{('SHƠP"pC*dDS)j'\J-i[ڹuﯟg"'Z?Cf&;QHΚGυT:ZU4e'N8Aٟ_h͇&u\, -8x$=7:m[nt5`a'H+Bi8.wr9S* 1'+} ԪP@#E w\}ȦgTo8P\s'Z=1YyCSk[F[>{g9&Ԗ#)4-} \g]_VOuN_VO QVe2<m<1x'ߋ)uw!Rf1Qo]I~7EBN`x ڃvt9nv nȈI {M]dPۻ'f;;+^C[[B֣>D=GD/Z{x3ߊ QdW8G,eщ~-5ҭk͏QDY_֧P+ |røpbr'o]Ʌ)خz.榬D7fEsI-ւ12cf OɌ`TYXGWyu7` kaP’[ւESnX2ψ83twjFe !ޤhEe"q&2XExB|XRxbQ<|q oňFDGQȢ/ǝBm`e఍y*aAyЁq&E{2!R ,@  TleTH_7xzh9D hoš)ǎkkݭp-_nuOOQ,*w/F7i9DWfL6BY| 9WDF NiWZu[\(e*a)]O'4-2S&'lENIU#bG=WbbQ)KB?1mmU}?3c{6@<޳gϞ=Z߷48=a;0csصn,IYBz=T690[4 ײetJc>}OO2fv 0`Ϥo^5 mK.XFKf[2M"/0 s6pKQbE!].e Djز1PH B?x=όvSn@˅]"싂]AZ։2LE3BXDv\vhH%z,UAZ5?dƠj'rhߺVdݞl7;}tu`7L33tLז$bJr!Ʊ怊IIHMH(( H:#V4 !҈g"ҧbc ar,Zh8g!ێOXSzl\ji{kp|`ehygH'z^^QY^nni)BQZ}'o~}8+TBd}Z!ʑN|F'ax/UY#z4@[n=ۤwQ, >N~2 2t:&dZGSmx]><'ufv*B_S)4soa|g!p5Rj|2iֺkUy4yp`oz;9 ĴMGjF{t4s˹1Dh/b&5Ҟtݩ)xвs,D>z~?yhE9jT\x7ͩ[O?ȯx>Y|.h燳ԏVHY ZMBA M bD[ZiM֙%M0A`[(<͊fLZ%GoM?{466voz޽{Zjw AڄP-`$Hڍ5E݄f1 _:zd+iTT(oO{㍓zj7qKm7^~Yόڼ;z&!ZپB=$\=f\GS}Tc$$H|!FCAHe9dM~oaE=,VW5sQkϳKGLgC3 *ʠˡQU(dT| :^58PI!!Еmpa!646ј_Ldz^T%(6>e~ӴS}?<^r=mDp2r^?4? `2@$`BY7t;<<>z䆱J쪇SLDSN+Ned#uZ _fݳ3nqϺݐVEЕ6MYıNh9ABrjVhm<[Y`v4e !sȴ i̊iYgG8^e. : Y0ost:ss&5s͟%AX_ZSroW\7;_m&!MWq Z+kK|}˱FU%eT\HoAB?%BlZu~O<؉BiaO<~į?_o?]-Ȉ6S ra%Lt^2zhUlb,/6;E2=d(LT]œDHIa2"J-8z4w?őd]E, |37XD $хZUK2Y)XlxٞԬ:Soӿ>4@~͸AP,ZWWq$1JQ~sq? Y L<"DߎO%x?2~QGI= kPKe.=k!yF S.F,siؑ6Q.@=]cYil%D{Z909.W^xhv|ƃ"5>3O<?AYY7Y_tV?FzӲ S3vC߷nw?]s} _CXįEU cIC)B)fX&J+mp=Knܟ. %ChZNOTQ"_/L)8㑅QH6IvZ吕e~9=*벮ˆL$npfІYUoӵPc|#˴XKϥeUDXh+8@MV!FFBHr$0Ȱ >D#mq3o֛N= ?AWfn9[S [;;xcYx98X0tgP_.eʆ\xǢD,&;jd"~.e0#,U:5jcFYDʲamw;3HW"FGK͒e\^n\4Ð 2©_^^YYᙾΖNls_|P6kyP3?613)n~0w$)|XgS/?hwct(tv]AM >{|ve !Q\pB2ҁ#+)!g:LV?Mvx4<򸵵ss^FF:gVL Î_5- `ԍ ;M®=l "l6G% d îJJo'?7I'oB$Gיruv+R8ĜnOloO"ɲ4SY=|H1Ȅ~fITX(y}̗<ϗ\UIS$!ҤJ(K9؊XkqdlWfQ-D 4*B*Xb.H6}'QpB V1PfGnZ$oxN?do.3BI7Q]`̠PIm`38 c2QUoBLzt.3f|$hqv~r.vi=y^M6F7zw_ endstream endobj 350 0 obj << /Subtype /Image /Length 16958 /Filter /FlateDecode /BitsPerComponent 8 /ColorSpace 455 0 R /Width 334 /Height 250 /Type /XObject >> stream H엍_+Kix )?׭#PhB‘E}*߁' *|XɩingdAY~*+C3[ Uhh*r! ΁PH.Fd3!&{?sOJE}'M (Ku!^&.* AIIG&*Mv>4 ;K>H;&A(7Nv!.Kzә DPͺDT DO<7]O c),(.** SZ&(E4hdP^Q ު1Y0=E3i*wEj"B嫎.mn#wOY{ʥMf!#%.oik5L+cM|w!۟cu LT#PHnY*+@ qZ X$mMSasdGk,VN~-%+VhꋟyQ8ǦJOTF݂nvP7M9g:>8щ46hzD+"w JC3.ؾpMuNȧ SM(E+$rLMi (RNii:iO ͨPlJ:yBi DM:m:J+R P~$TjZZD:T '-vJyl'7Ls9F/h:]8\(.xLRae;;ym7Ǜ\Rp Q]E1.TxFD0ۨ.:*eׄ i&q{R I9˅H4{!7MK 4N)W##/Ua_EF>tŦB0dL$3o*@,e΃Kfj1t }"c,Gj~G],ⵤ-݃_qh+džyW:wp1 .i Z`EbZybnֱs&sКZXzk7Ŵ[LPx:]4ЈAOT=84i<܏gXK$H8 `LؔҤ lW‰;(V@\Yb~#^zW_kcXw qb RxtѷϜ=WsMWDv<ztyLfѹK/](x7޻< _j<#@ }AOs{gLiA"%ۋ.Iƶ ]za#KrC8Vtx9gY '$@YyxLg(^VD>!y^SfPgi{5=*KWuXu(/V<=NGE|iُOr,47 '*/]u+MWO[P^(ϣ"*z(VE _k﯈"f*EqYز.פ3iM̼&te#Xq.koݻ_؃ {{ =s8|ߎÖ?v)Y<&~˵:׊{^?t W^,oCATۻ_O 5D}M)Wx2_.g%mUeI3S9dgB۟cٿ|8)›tzBTf5Zo(5x@`5 9>ũf`j@7gz.5ΈxL>˩g,pQ@lpS06M:71;2!ͩx6R/KUb(=v.,bU%en Ӓf +THgP%tE%mY}i_p]\6"FoHWۯ ]U^vE;baH ¾!qj5N(QFƸ1tZ-ؔwrH2=ލf*g@[y0 qՀFeR@-qri34T:9nθ2I(e3Nc*&7j0c4y `8b6#^} د>zVD/Xx'[/_|p 2$hdt-7v+˵le"9VmX&S)q[y⁣%Ӱ^6 bR=. BdF@N6H\v'?TV7"aSW/0/5E}ZJF{`o /+gQ6674\RHHYޘҚ~V7JXm n8&Iu;Um&b6$Wwf2]G7` &=w,8{0+؂CY(|h`ľa[k uǜ|VޟfiO" gߚkZzCVMSYmSq]})p^Y?7Rꨇ+fXD,Gft㱉:S!p|1#NX>gO~oXKJ&KFa;km'RU|H+07=)LV۴h*i!y^b9w7ֹ}8M2+lo7ZҢ',{YOwR*,>'^ȟ2#|d*LS3[J,bX:L+,&%N4aRe-a**64KebldRL*i\qU* SÂ0ܔ16Ɖ`P}OgeEh`WƢjvH`@@=@Q<"((0xtnQp: 3Xu"x1y"LL ;7`& c19qbLAqslj0+݅Ի'U7,N'0tpCxd17k$ڹ~sGϰK P ;fר"_1䌠Pɜw563#BYTTDRMZH-n׿oQ_`ДSJ>Pո$4ULť:;?J8wҹghU#e=2U5 =ra@@tXq:j,[p#E^04q\j ʳ*kw,OAˁQDZtjAyJ%РԜh~9dWJa&r{8nXI #i/Kb3)x[d2ʈN{n-z:ؗtsl6Pf9\֪{:|}^_m nWor\ΉHzڊ%vekkm&BUѩACCϵ~bԧK%rJO'n;S};HoX^]ߊ=PaYK]m GO;Ɖ*n\ +9牠c!Ӳ&&|\ak04MVID "GƞN G,#vlƞly5eSߖږ>DM(y5P>~+BZǫ׾y7twsdg6S1&\m gkeYH4dM4;n$kF߮{4\5ۦr悋#ZNnٻ",` j/^\ؓgGBy^Dss(`T'3Aon&ϟ5KeHxF>S)^i4!"ݡ:C{<<~v-z TB ObM,;ZWR>=aկџuN (8"$NjW!d !D[ -^2|]Є[" phN- ΋ۓOn}pEMV5TKVXZɹ[&/T1Ά MV}&Fz:] jQJFʭ®Yη*{fH`J8 VThm5ݼqWWC%-jM1MCbW6 Gs3='5<؝L4K' ESGTz|[Y||:oj7EGd | U!̐ Xۛ">2 I 7jl:f; Wu^zch6y"TZ Dѓ8ȚtxOFSȽ/UP-&X ta3Jng83`-\z"(4iK rn 8hBVS}4>ꯝ8uwV,f[<`nn4Kl4=MRɃ:R.h&%^T{NN6T5a5Cg 䘮-sk0krg -;@!$?{6CS 4cx Hjv:dI ;`t ?* ن8V &],vFqbg @Sh."9}]%v^%J7$e\.\ p=s rA? pDq| g !"hڈmrЄ,*pn !PPB8дhr~9CRvX7-x,Aӷ;h@JM*@FKv qypkN7TMAz=]u.DSIcg֬Un:xДX&aL֒3>$$M_Sv&n'f=$/O=w[s)|&!q:2h=@<8i^on쫷&* kϸ}†f롉mR҉ƛGCn.VD&&~AhNl‡N+|, dGr;R% E BE<&^v{D溽ny;B4s,DWtM5@XR=WY6 hV->ix/Jm Y(b2"-}u Gh\+rƮ'%wj8w5cmݔ{FUg9P޽:zM9==7Mr//~`m3 iъ AYl_7)0.฾Q681H,Fbh%r=:$@۞<.9@ @@4f>  N T0 5P_ͮH#GsijZBdDcԄ:?Ƚ~DO2}O LA97BД5);vɅ ]ز˧vZVzVZEBUw]8=@^[ OבE4(wM&]gO%D7E>]^CIWľlx:TDhPU)C$<fVmeOԌx:#BH{E A >᠓ )DŽ++}_C|oDl~\q4, 04,kkuZnVL3"z6 Ϲ8?)L };?^@ȱO4 nwMB ґBM( tpd?mwCڬ9F~2-O>>* L!zc Xht6ݾ)aOaYՐ Qv5@)L# &Մ# Maf#thջd8^\8%g݇o,7ηiYzqX<Xccebyp>pz;N7[c.pnYy ӹXבEAL)MtD*(͉[md2Ѹ\kRog^dٕYm"imX|۲!EI]Nʹ;NLȾkӪ33Y̤*fk`?\*c)2 I*8%T5~s&P3 0sdmK g 6;?Aw($)]K0#% tJMPXt_܌6 I R2\k/)V2"5tȎ;ԔAOkV5nlQ!nLŶ:t-Tszڗ3_0__g*e {_KB_~zĦ֞nq=ɬ`wwvU̗9=Z:H f5?.&w Em~)7SuƜ9QdRɻ9jUw|ٌN5v."KYsTEY{LJurTl4c٘vi`i@а~ZQt?^0^dn6pHOZ\[MRHC)bvS~kBBk+oJT9FĐpu4UmCjc#fӿw3;<_esJvifGw̝<?]w\r\}@K &St?)9QM/ΥwfAC1V'3حX#5 9fMyv R[æ\m|R4ᆇg;Wr]K&-5f*+GU1mW2Ǝ.v;lc Oc &,] ^gLݪ]bjwuH}bᮻmW]<:ֵn^ Ms=h0ݩi8#F0TVF5j5s<+0hw(D\s\Q $}n#_TjJXJ.g5SI13tR9,IJz%dFIU0ߦin6CDTNӄ^UI{PM[9_Tzotpin"]7 &'a)X +J3VV+}'7)>|f`V}| J;c7*vv&~Pbx{ wB A.(b2!-hUxKآXj͏ C'WļE3xq0MsJ}gDO?yiBoѤz,c)ФEԝ p__L&g,ĆK}՗[; 5˓/7AS]YPM>r[M0 Uw՛cgNUY֬O ..+;k.9ԟ3N{X T[$Xj=|~&MDH /bPdRjж$]t@t)v!{SlJ$=Ya*}aoz]}j)IlMH߬TMpk=AvzmsVNt[!~GD.`ŦvxSgAT?̏/!lVe8]ID)&bhI ۰еl_YINꊌ_s2i Sh'7~= CoDP<Y ֙T5-^/7_Ӥý,36"F,l`1[V;JĬ6#h4hJ86ڋWIuK7AbDj_4i-ؽct1u=]}6=x]:i~6V9ʥZSgY6VufAgKp7VqB}v8~bz;j+=9Թhe{eΥUR/&-ƕvk+C?N|iQJ)Υ#5CڍǠ ;iRKi;JM :-?%SI399{hѯVwDhu."ƪ#z-{MO4}"Fgm%z'J/@C}W[Ln7 .F6c!!x=r؄`:bLAJH6ZJ/Zeq:RHv$kSU_ڧ}٧fh+e?s?H}r"h߅4BHǞ6APXb0pB6ݏ& ?\ҖF$L&"V̌ݐD?Ji@L袠ՆȄeCUtU6q&bp$$@ 411^aYPqauE2Sl+ֲؒNi(/ku_7s>"<\oh~dޘɾ$ߣk{n_J^ԦVN'T׬]B[ +kNjfc掅tygzͩ^3?[Iq@M4kʪk=NFFpm ȭyyqGNuE΃΅9ZӹxOߨigUveo C7}WyqOwefy ZHGz^{Uu+էt/?Zif廫 efVM?س=d!^Ҹkq;(u|EbF+ET߲LN Eb>R'AR!MZ%.`~*:'DVjD!`ӑss)(ީi=1sH|ny3dMI2&⽰I #DxEeٻ'2vY\P?֋=`6=ujXVAE#æ?y'҆܅7K'ZF&CgὦRs~L(f^mg_yK̶^0{:Ԕɲ.|~j$VsbH)`?O)`MҦ g_wsjǩԳm6h~q];64 lVW\Bv?wH *bSA6 IR"2y}'ɸvѫwݟ]M[iؿ32y Na:,᝿}Xݝ掺ܼ[-J:|yP5XwveԵ., =?Ő }{q4iw7*2h _YRDgS^qjCnHTIb9Ly$n2"}4&R c YL> WWۚǛ|PvfGֿs{O K۳+.^:cL\\;4T-tn?`+[juԪUK J=YYz=ٯ R*eS}޹'MLdp;]\QB,^ABQAA;'Yȡu6sY +V\iw̧+es}xs2a#Wݤ_u(rrIi2O^ΙڧQ8;y_ݥF' v'2Fe $D!+@FX0.M_D/ L2/#./ ywLRSbzE>; h䓳@M. blA3`>t'Y:{ M0'>?BYNAT3a*6HGv܅J6͆VE@m>GX|<8FlJCة`R>$B Nvhr_B :ɍ#V6)7M0&IpBX: HAxuMn H;8QD,G@ͬ_"x Sx ;fN,p@03app=j8Ý!4F  #8`13A~](DSPco_KR,"X%dץP yo^e'8Ĵ2ZKd qFq,^>GTI Yd$mXtG86e"qiHY H8(@&J4}>n@ ZAӈN' I`E?5-2~VD("-?(ˆ30Z#WnTfQ#$ؙdR+DD)qZ D3 RVTDlH,psse$e?;h$7M ji&WRBJmg++=Y:Xղ&\;Oxu}s9t4R}vM6wp2 𘮚a^2}5Ͷ$DHRM0OOT7w}%{=0Uz<1ŭ8Zz[Յuy^i1Z,0b> endobj 352 0 obj << /XObject << /Im30 444 0 R /Im38 354 0 R /Im39 355 0 R /Im40 356 0 R >> /ColorSpace << /Cs6 1230 0 R /Cs28 448 0 R /Cs36 456 0 R >> /Font << /TT2 459 0 R /TT4 1246 0 R /TT6 400 0 R /F1 409 0 R /TT14 422 0 R >> /ProcSet [ /PDF /Text /ImageB /ImageC /ImageI ] /ExtGState << /GS1 1251 0 R /GS2 457 0 R >> >> endobj 353 0 obj << /Length 6086 /Filter /FlateDecode >> stream HWIc_aqbYFwCcZnCK4=o9 {4qb=VUZ= /14h a^I[cRTf͠UJTK*x;ܶ6Eݮazq"?%eMEŰ1N"-i0n*Yf_)=l5!7N=yd#+ɔv3#O:[U 4U&;kelq7s$rR`!Le %Uۡ]SIַv¯=ev[b031n[fyNr`YCs%\9[8s(Ha8^1K]`/?#FWRwc<ߍ^ku?:kNX IɌ/LU@DE$?EHXar~11ncF)RUAIHLE 6-!~J Q '&Bnr'aէyJ;<ȁBuj0i҅\]{/\!$h%fRd9s@wry(281/(dv5sF,)=3娔TEJvMոAZNvՁH87MGy]?9Kk/%ݸ-$"t ZbEۂUm6Ԓ"Snt @%q7q[,ƿ.`xܼ#Ҏۯ/2fa{h>R/(zjHwϫ2ip@2gb4f #o("J hq7;wˠ~'ÛsL?XӁ(NY2`u\g7IdWuԳhEnQ=aԅ,tJo+yq)nW2{Sog{*9W~s4\ѡVǷ`ұ#C` Xܦфy<Ql0`>ch жȬc`"/&8`51BFf0d8@Sxp*R:MqNo_B"ON-$#74V2 }ᇥu)`.2XWl,FbmX33l1b-ike  w@oT0]Q< p+EgLS]qxI}_q0N&Z#r 'I!B6㮹F wgj :Js ̧sDÎc])? v)QFۄ9oؑ~׏47~_jZW{o- Yrdfu[l HЍWff?Wg8Kʡ k֘6qtsC"@fC0qA$˔(NϰA3*cdkՙHT$:.',,&Soz>*^'h(Sj8α%͸fwPGx 8&Ң&%ӅBr1m^|l:X @IsC6ѱ:BITT>1&LK+,k(0X +%Zw9aH:O4 [N 5'm(h)h$B\&Z\tFs *h?Dj'yZF$'\ jN)Z[5dtei؈GINh:˃A @4d!x'VS3OD9s[Pk u(N<3;p=X%פ01ˎuWj xKg(Q.g:C&y&zsQf’+Ib+U;0p/`k=# f ̨&$c".̋7*5x5e)<>PI42z&rq!' ?0GE+d*( E92>u94㥴3XI&bR*V`9ZS ׃r9KUAʡ̄8 )H>rgSCU t#9^3_v\@y;,L};_*^Ȼ`_ ,"F煒nκ8:pJs7^Ypư%i%/_wxjQ@aOƈ^ހ}JCJGփbFN9H=Ag&)hUxgHT Ϗ!q7BT*/BV:8ѫ6C_qz*"|<t%&uǹ abż_yx9{Al&?NGt2Hr>qz\?w*,5KOSmXqzK0"K'tEU`%MU ~]F!sM5I'M,LXn S:dQ'(!_H5wAݚ=V}a'eFIu).$•3%NiدnaeΰVX\苹Y=yW( 7.bNs ƃ;Qc3%)+PŮЍh+|t5.C$#7'T4qvJ=$U]uѲL# eœ;aɵa6\.ST||Em 0>0˖߂mѯ{mubk3.Ay-(/B+87蒘C{qwr/{&>~!(ji^e-Ns9*$ݱs6fi^-~r|KһEinܟMcSc+%v/Еbw/(cɁ SڧqEڱ7΀ͣum3@4kNk;#}.ɤڶyL鲻bps}5˞.h[6= j!į3 HGe`.quznez.繝m;4*M0ބ zc3肤;P r@FFuJUS#xv ..@0Qq~j IY+Pvƚ81#F 8x~rի@n,Ẅ*+a.su wh*~c0''Eܝkq6cb,e/cbuwvū;ziZ.X}9qWyxT#tBN u 9:}\UOUiV #Hu^HB ׬Ijw;/l}H $9u'L=Xu5W\ǃVc=m1Cc&A3ʃlbO>YAHѶNq tFq.0[8t۶٥ ?Y݊bt$vΦ0/ bgbv?5 n|šq1*ɮa!szmm}}}H$ٯT.@8] 0v`^V%*q}qF4AFrS/%ƫ%J4[}3V59Rp3GjJ`jkZ?n>[qKgX=YJ@l~RW?+ &7Bo~~{ҍ l/ּ(2v`~Y!?-^q?+c!˾,Ecdz̔؊y*ecLpΞ]ǦKJ:lrs6{c/|D\&e'I_Ta%glR5nF05.xṭ̌ ޭ=/匑aIQ-&W'/;iqQŶ݌} Ddr]lj"O/jDmNg{siIw`ݪ ݓPud{/8|$1dgfA6,۳Kʳ ջ-nR5qgOq*ŰkFzS]ຌvT!-x~ 00w endstream endobj 354 0 obj << /Subtype /Image /Length 8927 /Filter /DCTDecode /BitsPerComponent 8 /ColorSpace /DeviceGray /Width 271 /Height 204 /Type /XObject >> stream AdobedC     $$''$$53335;;;;;;;;;; "  3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw?1:}0kcX#g~߲zmܗoޫg%/~r_zmܗoޫg%/~r_zmܗoޫg%/~r_zmܗoޫg%/~r_zmܗoޫg%/~r_zmܗoޫg%/H¦rLcm3WK=_?/Lcm3WK=_?g]UP+>N;dVxyͿoJ$I$I$I$YWa$kI^L3pȑ}dLNʑ6 p.1s1Y`\"9QZni N8橤I$K'nͿoJ$EW!7ܛoE7rnOGܛ#M{ }*⦅gʻMK]N1nw}4f[WM[UuwʷItUVIf`<SWtu4J#S'K7륕;wC3n3q# G qOW?F; *Ck3&EZ ߩ kmq'BIO0RYau9W[.qmZ: bm4]iIdO_ c(?ӎI*Y j==lztݻT)w^Z2K pxAIلA<Yvgpm8eԏwR>,q=&5Dx%UXm27~L 0G(YoN0m{Τ{u0,ȼTHpm9;kzS<OoR-_qhޏVEQWڮevQ y8ワms{X[K/ǁmu&{qqU:uzn :Lʏڏ1 N'kG%'> Ğ`)HPVCgsxao3o[RqI%O9s]h-|BifovvcVƼ4s_ɀ=!eȁći1%IH]y\5ҡcג|&48#T'f\}tVY^miRQi?|{%8ƹԛ+Cee6ُ V6~%Ʀݫn`i =\~shͰ8DZ]O UgPȖVE!5Byɦ܊_$m0x{g3?L8ABܚC׈&;ΗJ8k3~i 5Q]M4]ce6I@=]E,k^KcԨeao3o[RqI%S:ۊQ6U+TsS,a}V0gX iIyks\c1)VvTN;֔zB쌯ai:̆ni'Nitߐ[O}EŇ#!ޤ3rNy-@aHUTq{},$oy%9ؗf^,ǹKi10tE2 YewZ,haupJ _Vq3~[6A׉WkmI,%Ӹvo)]pkMt\s:KN3m2^ /^dzC>6:@8橤I$K#~ͿoJ$,ke<[ѯ:}ڠ~جXw^DDƅEIڤ̆;xO2DtKTND\Ě|NʭΏ\J[l*q~#hӰYg;98'HbllȦ i:o˷?#'LLgg~p ?==%-|qITWTI$I%XqJ7Oft〒H{J:u~ g)Nhw 9dl\-9A<`ʤ|LLA1cqIB\NC5"?GP,d0<. \قS|j{.cY<U{J2T[rj{XƽsgEkgduLY0tT^p4G{NB8橤I$K'nͿoJ$,zu?.k7184ĉUoՏ`S[WըژN߭?VaOYDƏUޗcn.8?s^q{뱯$wPRYmfcou[+(7'OCL?ޛcRʺ>_/i?U=6_%G+*Q?P~'U$ppq:~%xxUqWX&{r8橤I$K#~ͿoJ$Ϳ0g;_疗jGcEuaEqdƼ-t;Mso Yk۫tܪ8]]TT7^t}i\4ZtwfbǚE{va8}VU /h:ZYgwDQk_UK]SZKIխpw P[S-{H:#i!?\NnjJw: RI%Sq_SI$I$O_ c(?ӎI/&#`'Kɪ9첺ki~555F"gUWջ(ͦܲ[@:-S:C S8$q}o 韖DtLƻ @gr,Jn^s|a;NK&G(<.87L鮝#CAx.,ohgn{Nl>e;p EŤ Iap`gYkM, oahh$8橤I$K'nͿoJ$m.{bՓk'cIcfp$yy۽H/sk~U2r32X?ip5[Y[yӮ̈́L %be,;4tp ];bYl˄s Us끥d01o$Voចh2 ݄tDα:q˰&G 7 (IgÁ6>)Y^ָ{x;D aZ}H^1Ҍ50ٷ?J0wS \DI:|:I*CjI$I$zkn)GVԮpdQoX.{\;)Z]q 1IOGWk]] owtOV6CS"@ sVj[wm[h!Wl %#QNƧHS-tkZiI]GuQ^湢>23pK)SfVU`t#^S\_FSHh7]@CikYHlFt$ {|xͨ*"]-fV Oߠ1V}p;Aj8橤I$K#c3o[RaI%AwXƤV]cѽ˘ɷ RsKLI1rnps@y05&Ľռ5cN2kEͰDVad1-`k A' `1k8J~i8[%uZHcQk/sò!hrk@}u;yPmN`sZ]O%3;ݖI;$ #ai,v" S"<9d8nv*xm!Ůl0 uJP⿚I?5 ed>S:kn)GVԮpbSmbD<{X]{Cn!kX0v{>jU#s.li'T,sV3kh=K&c /zh?oOصSo۸u+oaFGG uƞ]fgm.!ֻVq5uv4{ k}-2y,׎>̭$f\17Xi̴@覯'W8XC]zA|w׆U.-V.XnljC@&H8橧  Z֗tBv^= YTp %;c-1%[$;@&x`dOao3o[RqI%[e oJo(hM|LӏhHcCSš@q1ܧlxIPppHRS+qhEI 4$u0$ITWT\C 8|!H3_%f&+]eaQE~^)}nm$԰g돼:Ss=8h|̔t5uGVM,q$rJ_`Bu?{IeDVuK[WQhn{i\ t h>]euIlPѻD F0~#F uJ nGu6>hi4GIMql.FRI$I%Sq_SQpy$"{CEչFr}dUWe&<鏦˟Y`Y!y l0t:7 '~ͿoJ$Mt K:s'1Hdkp;)ۘ5i~m@h-{yk]w&; X9 >HnwNɒIp>+$C񅵇FXi;V,WVG>a$N5RjbS{G~ {|;i}I 04P8\:\ǍFAgI O3IN wqzkn)V:w6U+U-c.`;3斃FnƞRdqx0Dx1ﰂ3w@i;mΟM o)>̐An_$4{;%]aq CK&{pe-c] {An#DnV :48/R.!~HpZKdj8?"I*Cj|SĖo.1ټqiّ,NWiwJk T:2ebrv6I5E4q6c =:#}k ?~ͿoJ$=t|+{-kಿCy2sr͎M$3W`t[#3-lý gqTA;/S>t"ᗔAhh>ЈSW㡀3JϯogrZF`Q0~,ʾdTAriiT|D6?6 m9I_0oy' ozfrϯWqSϮ=:ֲϢSW0Lϫƻ{%-ZtWk10csO*I*Cj n55Cз;mN3 Y۲ kKZYF#NZow$);l܇=!Z%*_ c(?ӎI/+^ YY$ƒ.O~3kP6e<:XC`mEϮkn R,x9H00MQ5Kpk]NJw5ƲG|\|N\"XKn| 1>kh`:򯟫m$V=hm?Zc+.n:l%E=U[$:vkix+ޙ; 4:8u{\v8;K8]M RAhVRU:C*]NA`=ѾUoaef_Ɲe~W~Df70s;lznvt vW}[YmheqO+_PY?5`Z1CV{|?k>{|WR'e}7xhf4mih8gIEU~7t'I'V`8_IAv٘IU668GIIV7b;A!?@p?$>}[J]+W^;ȃtrV27Ol^bM+7 ߐww+Hw:l~)F?Vv?wHg?_WY:*uM;N+^hTخ0s'{|?ߵ-.78 2 kDmic-Lϵ-70w',àӔK;%11s[Z5۵KuORrT7hE^^Ȫ'0$Uga>˘r{r_‹c%-i'̅4I$I$I$ O @pB'p`tH$Q7 ]V6Ǿ`7^(<>G+"[C{_Yqd,n +5qJ/q4XktkR ]m"]m"fN4o[?Pc[,e{^ߢSF~7R~7T_X ɃUzAG)I$I$I$|UuPH7S~vT-.i FL[,c6O?DȥGmTvkIPa&}7?~6H6m]uV֗ľYk X_5?:_kttٯ_fGK/5?:_kttٯ_fGK/5?:_kttٯ_fGK/5?:_kttٯ_fGKUgۢW endstream endobj 355 0 obj << /Subtype /Image /Length 7915 /Filter /DCTDecode /BitsPerComponent 8 /ColorSpace /DeviceGray /Width 271 /Height 204 /Type /XObject >> stream AdobedC     $$''$$53335;;;;;;;;;; "  3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw?1:}0kcX#ge~_?/x߽WK^7Umle~_?/x߽WK^7Umle~_?/x߽WK^7Uml(2+MVغ|jK]?6?&NOmI}܌ojK7c})=}.i# e~_?/x߽WN:E~3ǫg%?iܗzr_~ǫg%?iܗzr_?骆Yrq"=ChmWN8 $}rWj.aCv. +c&c(Nƿ@'h䔛5~8H?HeY M(V'}OXGލۡuso:&ލ]߸%Q愽 ?ѷЛhM\_5?7?WckƆp *CjI$I$zkn)FVԮpIygpoX1+liOهd6~xr:M$] SS+CtpYii ξ'TwDѺsqpoSvKo4?vaum{ :v&btoFMkI&$Oݪx''/`gcHw.iBoQq`!ZN%ڸ&.ACa4.>e-P'AoqXcڻk K^}УnSۨ@t_hn\\L@w氆j`ZKƀ#T8fNA#Bj[Fuds E<{l k{H׺I%Sq_g[wݳ̨ʋs0`9!y=湍t} >"Rsihq .0LIa6w=,οۊQ6U+^Q7w[syn7˟踮.D4cƾ։V񧼻Kb}bPߖʭpoӂt˿KGaX7h`~kq.-i/y L_K dL M{w;Ӏ;'}ӭ/k|d}k}&dXˎf9"!ǼV[vMFZf68)r4DhJˬwZ\8S69bFi0'oǕr ^DꌒJP⿚ N3rh}/k^ Xz[:^'+{`{᯸Vi+ק7GtZ4u-&`v9Ay.q;Rk ?nͿoJ$޽EP%{\YcWV*n&DݕsWvQ%{l#Qƴ?6A2i+eu6L_eۤ󮪻 v OY`n9U훫ui 'ۡ>KT/ORav, G&'Bǖ^qnxV.!}@H[qW{RO\ad 4q)EAKBlUւk%jI*Ck>z-!08C8}#DAk+ğ'!KX;pZX-:>:ۊQ6U+^k3Egǣ?rpC̭i@]Ψ= i2Oڙ05q}^lcdkqUTfv8V"RyvF[Z0:AmMΨﰚ@[>>Ksn4Aqw ]h|w#t$淸鏌5#)Zq1 GQv= k]dA)~n.6uz븸YJsIuصkNԒU:4I$Id07R]8$>}\]_Sf-N56XѨsjU,_Aà1*_e:{Бcpq u}Hc|uRmfik= ֹK{NmT*${ZMl8sY?zT>\1Evr~AΦTsX$5N{뢳4<ή1?a:gn<'1voO!fߥ8Rv54`T @8*5ṻp+h&@R[az{XsZ3úG@$N5M$I$Y=?5mWL8 $mYYHݷ-ڞ%k1 RH;hmCw~n2vRטpW;ۉzN>`5{n]A$[Ml{A-hk*}[ s]>{wOe21ma`CM垳7F2qw YpLr@4<Q:$`|=-OnL@5ׄ04 dDpSV$ 6O$ ts~AױN,@$7@gowH"李isZ:{Ta@餉fT4#\1S:VK,nh C=NlN^I0kRsvrD%H挢֏C2xu 'B'A>ƞK%aFy j}1Ֆ7jħI$N5M$I$Y=?5mWL8 $?Zm=QQ myuq:ݦ;.}$?fpFӱu]4$wU[ihL8gOr yf']Lӏ񅕵a9fp4>Iaa 5ni FQyXpPL᪰񡝡f GA˜]4:gI "_C=;fRhe K??gX?;{+ST;5w;Ocp}>D!Lqhtcm4s@gqx-`x$u+i$I$ao3o[RaI%&Y5~؝ںW(Mp-Gadg !#gh 'VR,k&5*ŀQ43pu.!\=='V\Gy]+3"8րxSyqʽ1~c߫iM͵i 9XʝOּCu +@C8=Zt-R~L&zR[FbftW hVRU:4I$Idu07R]8$^\(h>wKOsb\#@cH@<-y6n2LK@ y#D'@4Ü[1QI6px?r;Z֏k[ M++nͿoJ$}yFW_`զUzz}gN%%kcLk plc.pCϲEnKHpw8AG:"Wcaii5LA"N6LM`%k#U?@w=6^twO^M&͍l yM{6 d^۠~(zH~B:^+I*Cjkpa;~0yu8aL }D5GK]>)!sL8Rokn)FVԮpIp\PvEN#u++nVʧqvtţ->sl` #PyZ1]|k<~ + [FPU;wvۓK%c pn$rkmc8AxטAgБ?"UMC(F^@ ~*|! Ao 74i|&4o8yӲnq#F4+)*Cj'y.:7sDz~5˫M=!M?!8CΡh4BbǐARx,ۊQ6U+Ycִpsy1+֮5-d~#O!_e~ڪHr CI*XJ!#IP˿GQk#Л/~ص4|/?XʭQNg'W mͪKĪ/7k ;{G @ Z!UakQ0Y#E8ҷyǨcRg?״Fҳ?\}Lh'vY/:ZJ8mc{p3уM,1kZGITWU F%1?;K!H%hHiĮ-Ŭ6ִ2{D8k,ۊQ0-k!+K_______pO^/~ ~׷KM^?{|?ߵ׷K_~׷O^/~ k'ooQuq YF֟ʡ1/R1\{ gt\րXtrogĽ[;&.{}K\vInPۃەbL^+GHiܢr_Q]fj'sh֎Ot/E1EI&u%$I$I$I$CZd }4+q}gI!Lpcl{D7x @pJUPc"X<WYk ^*2iג $;/xE/xEB̜ ci~&> stream HWC-fȋfq2Y^!R89@%IDU H-x Vn{7^Dz;o{)N UY qGP@$֨G\I,?\sLdhlw֞lZm 6k8JBhIXJ]VWQ@kj9MY=:+ a\.g\ *. &I54Ο zY6]OP[ЄJu4f&K*-ne-)̭mՀրak47!l6Uu$ U6"[BN}XMi ,e!_%6Ѱ5Tp҈mVƠ0٦N,MW6'SOR6BQRYH'{ ʣS6U;nV}s81R(YY%TUD{nd͓b3X5Y~lJ#lfeȓ ; M@=B]E* ];xmڢW/f4 pM/2:@ ]4r:ab,=!l&PǒI6enS ԆD 2p9۬F6ϲl;"ۄ>*XM8aUr%\,z:ֆ~Xd %cw,#ֳDb]aS+f4`o2yoÖاT?^&P`+t[ J4ӕ J薂m!X⫖ZZY-3{:&hfm-<*lD\ۻTtM6 ߅j-6;igA"oHQdZv X ժݝb2IlE4񶙿 &;3)^f%º(?Y/k$ "6OoM,Ȧ4ṿaK2Mr"@ XN?4J؄1 ^ms9{)S7Ev͸Ehoz4rTJ46M}'62ȡ&|Yȸm7_[{sQDSl{\3f8J6jrh,reZ<:ToYH]q9'Z˒ ç7G5~t;/_-l|K{>{™//ꇭ%)nV 0/6|++%6S}`{x/=zf}īo#e#irBPܰ. tMOY޵o>~= m_{fv~~q2\rssO=`UF%MO%I_ݝˍm\9m6z]aⴥݶ4iWh:VrG6+(WwqE6s]lI2I= ONl . }ZK\>?]E'qHOb OBq]]0{:EYYH&q!-κT.XjޛoLuÃzn'}͏s=znluឱgѱXM`q&>qezdlDsaDizzqS(<~osw!`4]loh`K M#l1fsu ܭvߴū3o>:Qʾmhr>?Q{.e5Z#=~A "QNOeZwW8+rgA2;3=gvZw ef&݊\ythMMvzoAzݙ@H̢ɜo;9~7gȀo?Jx0izi`՞7\" +]Bb%.IXgE#5R٭|7>$B*R& @[k˛dB[ ERT*L J5$InlF Ech$ߑlYv#3 '^H+<4|KCHoP= Mf&;zBV OgHsf9kVi_xglqvgW,ۜ>2aʹ޴>[@ 8k~?Մ- IINPPGk'Kr\(24]o,MWH,T6[ͱżYЄzK/9D%!,lx#%.T ( S oZjXf❙s hY .9vOMVvr,-Zw؋YMʘzv8@Bx*}0$7&Tڸg}qNBzelZ鸏7Y/pABjg?E Gsnxh7h!ILЃ枷>\OمaUۉ?^z{w~~`b h\_]&`R4-3MϛG:h [v~G(9?r_OY4࣠BpS}8zn<7JV7_\xK vw&$i4K>$hW0MňVAI$d7Er2t=qԉq3|VkirCZ(9@IB$I֤gQ^y~ l0p#g}#dGlC+zjlHB^LB;B8rY_^,/YW67)r3D&CL$#|VE.HG18,@fq 9HXmRDD7B >ZmUH{piiip&vt{n6,T֛B#VnǾ"VDbN RT1wBلQ0I7 Encti$aUb#]Ky0@x "!fvB9+` hOtIDwM-*$馞ʊJF*?̳_*gEVpU;A>U V[ v L/ekӣB-h#)\!{e,B3mWS׷RG[)22-B"L/zmd,X$p:`|36L>o:NWTH&H7BӚhNd;zc iLEE kj,6탢hfT!|4͹^*tdX$rI; Be#ܓ~In5IYEz3D,䑃Wӣ1Y49h:R?B-t/fܬ7;ꅶm/A3srX9B 0ξdu &]o^HyDa)-5qz'H| C_'>^u<͞v!-$Rv+'^ hhf6ջHwzR4FOn MbulA7}i4kB{[23hʪ.#}gߔqƚ̀ePβDvq38d33yَL؆ RÛ 4Vhh"TEK[u mf!QŊRl"w޹vVݱ;=GV!oH MZk5YQ!Z^|\Wݾ Hqȓ|Ӟ&MEY%Sq}4y 9F:m'MܪgR!A*Ð|=X?4)5=B\ͮ{{!Asꅴ $ɛ݊JG#MI[!˺8UrYMZM? Lf],#7] c}}A7scCS,T(pW)}cG"O;u4DDݣ̄Q6, S!BM:!3'-IM#jr(GN[H젛LSR y|<M*^[jhj3iy~8ro/@PA`TR!82ӵuV +$B/D, +tr 7i7B Eh}9 &;ߴk*7]Zt FD4 };(є&Q*4Q oP i:/u75B6X4+(|3|#}U:uzS*vѩF F慝:]"{ӇכNB4|г=ט*GJWHޤ#BuYV <wb󌈌f7CQ hڧBI^geS7{{!fNG>OȼռjGzSt^&;2+Q!DNV3rW4M45Mg:̋ΊMH_VAƔooZ4|V!>W/@M/C:ҵ5)ܼSdyo &5W|B4^hnX^9(¡"HMA@1/ϔ?h<3C[LyWy0/UUTKcC H͉WRVr/D}<u Uhyޤɭ\[T;ygGFE):KW+fBɔH?^0 e4KB^'g0ӻT4W~8rf7٤f/}i%̈́w9)1Q Ԥ _Uͻ ̏"i TfVL Iʽ.V!3D3HlOҦ(<pV4U~pAtBS/=z1ǎD|h7&];€`l e tz4f$ ?yDɣz7琦Kˁo>,fp3St4|]>oBMOB+[r@MTBz]BRy݃4s~؃1GzfzT WHhC5P}4-4^Ω}>Hsrdc9kUލrq?^Q T ~k\Y);$#}!BEdYZD6H[-> 'qͳMA̷4beʵq*v؀FtzcHL |GFBS6 xTSg2ҩ5=pr6آtCɿG+k2zk,7GEґcdVbrf[dFlhR~B4 _,m>=r7My{ocs#G.mD , ݣ0ѽhpG].UMr8MSH/~uk^?yeΥIԒ8DӸlO22;(p9 %͙˲UӤ*No=tiphO2dM'Ho,-+y'Fo.=F﭂"u QGxxzX!٘ L5Es[89vtil[{ȯ(3; qqf4l\e.AwD ʳ>"a$` "#rと'JK9=cr5V9Jb[ӦQk?siOogw_}87tCMZI6l HMn?1ox0K(1s+o&-`ƟbeںK ns3>?{s_'/t:ks/g'lˁ>w;?~y``;_m_;~7޻7ҡսWv⒄h$U/݄T[^mN#D6yCFD46BӢXʯ=w'\MKE&,]`g#YBH$F5 $R!^>$i-0t= 1#y!@A"|%}\00 &M|h &BE,7*Kz|)O=Y&!Ŀ caQ/.؄t%7٬M)r$檣K1_ c0%`/ƍhd{rSF|<S f-E$T@ZνK%&cFqa FalhX,B*waөmdh^VX{Vi#^Le`LH/dZ!w;%Y{!n*EPJrrL7BR!`BiqQ<h;Z- TrDy:1خ˥ݞqĚFY8'HmD9F<kB8J$){"qq;燪2eɗ^,pa{5:g4> /ExtGState << /GS2 1251 0 R /GS3 1252 0 R >> /Font << /TT5 1246 0 R /TT6 403 0 R /TT7 459 0 R /T1_1 461 0 R /TT8 400 0 R /TT9 406 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 358 0 obj << /Filter /FlateDecode /Length 359 0 R >> stream HWYo8~_Gu`u[6^n33@z1P$E +R% /jd&`moġxG5dܜvK8 9Kֈn6J{:o[֊mu'Ӳ^$nJz2bh}59^#N>U8@1Y~qe$Ԋ&֍woMstؒI }@x-dv?_Cnd7ooM;q߃Y&ZqK3s"__ڊ,Mr {9Fd| vnˢ $˹hQbGC٭hd)( I8X(FA4ݖpsQ_+͖;#pWbx9&i`D#k>|NlS``{9QԸ V\3hYqGAn a} $mI,ZV d6.2JW KP^Pۮ8uі4e%i9:\֐Y]hL#,(и.gUmZɸ3gϧ;ʳ4* /9>q23Fͻ IN{'[7J"?Hlɇ,f¿;$Yf:7_k;Za1^wE" Zj.`0 Z0zBztiCgr;:&M# ӑ7DZs5^ܨzlHúj%(kZZNWOT8"x sNւj>Zڏ4q@yG0Hj ;QZlhv1̊b1~S="įK)qIpJG[NDb̵켦Bnq)1>\Axb)\[{If z첅!'=DS"^i /l[TOI"4vGQ`)McQ0Sb5S+yBQZ.[ա5"]2]k~8-<ɢ6(hpE׈܂=1bdV2t_;يEv[͈ %҂N 8Y~@Wηh 4 WC@(wP {GDI O8y NҦ|]Ȭ.n8bxQ?Zu}!/P(h{(Ox-k|Te\Q+8\)Y$,|.ZUXJJG@U/L{3т-5x6dv?_*o D`y+(j*8iՓcN07IagCsK=M8b1#^xִ- ")!)v2Ih61xRU?_ۡ9wP:]zbhX! Pi\.CC`i endstream endobj 359 0 obj 2728 endobj 360 0 obj << /CropBox [ 51 98 561 694 ] /Parent 1195 0 R /Contents 361 0 R /Rotate 90 /MediaBox [ 0 0 612 792 ] /Resources << /ColorSpace << /CS0 1231 0 R /CS1 462 0 R /Cs6 1230 0 R >> /ExtGState << /GS1 363 0 R /GS2 364 0 R /GS3 1252 0 R /GS4 365 0 R /GS5 366 0 R /GS6 367 0 R /GS7 368 0 R /GS8 369 0 R >> /Font << /TT0 464 0 R /TT1 466 0 R /TT2 469 0 R >> /ProcSet [ /PDF /Text ] >> /Type /Page >> endobj 361 0 obj << /Filter /FlateDecode /Length 362 0 R >> stream HWKo7W[din!iPf IJݟoܕ/5Pr|8PN R9.yf܌a>tX-&/sR'X,p]NV[Awne^a1ڈc^dj-MB,]d~BImс? qX(wIge>(uO>E$izZEŊeSP@QeLʤk.oI,a|^dgD/i<EI42٢]' ڲHɰFS2F?] I#NXCAL{JfEnEխ闤ɠ{lZQ,'y.Jl*bmPZ9tTx5d0T[A,"FmfYtXCٝFͫd,P NF~>_wjȳXq}*)W_dg!~ \\ CxJ?$ !^:+dH'2JǪ@~ry%uIK~.uOvu9ϠPnVdhK}\Y֦@ˬaxqW{u,[F+U EagGF' C.XA VT8S _!/j$Rr%xk9`-QfjF Fh.5*.Z"FN4sqӻJuƝ.6 ;|awwO^͸]ʪu0et'% mkTFH0b֠3;ZyP׈Vf^n8ŪBgQ7#}%^'n7o޽Ѣ-ℳeTSjkx o -vY9="4:9 Վm|G=Z0LjRŷO^BD& o˄ J[? h1SKl7RN?>>^5rPqHw-2co F_%z endstream endobj 362 0 obj 1452 endobj 363 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA false /SM 0.02 >> endobj 364 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 365 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 366 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 367 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 368 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 369 0 obj << /OPM 1 /OP false /op false /Type /ExtGState /SA true /SM 0.02 >> endobj 370 0 obj << /StemV 136 /FontName /TimesNewRomanPS-BoldMT /FontStretch /Normal /FontWeight 700 /Flags 34 /Descent -216 /FontBBox [ -558 -307 2000 1026 ] /Ascent 891 /FontFamily (Times New Roman) /CapHeight 656 /XHeight 453 /Type /FontDescriptor /ItalicAngle 0 >> endobj 371 0 obj << /Subtype /Type1C /Length 1739 /Filter /FlateDecode >> stream HtTP߽CCXwr{"?P@t@@S"l\=jA*%R1$. .t c&mՆA4Mٝ7o>}>JA$9syzFNڊٙbܲ0:d.Mѫ-;v{q*q`~(/P luUY7"sϋ$M;a'+O1TZd6Wͻmƕ%Jer)hL).6yٌyfjh،rkɼкXݸRRZ^UfS2%R"-YLBlB R~?'@В B"TAD$AD+x%L b=BE -4M R8xdV!e*@USqT6>fwK ߤǫ5rK7!A!,tHe5)akq aJ3q-Zܚk rs%wz6wNas+j`eUY^a_ C~TkS\I4gP͋~u'==Qяrѣ~,n8^)q4U )Rhfc[Q*=&7c8fl=!h`j3G7V` `|"Ü4<9 uA R&9u3ΉQ95PmR]e!ɵwPww/w6&ʴК:x8ǓR"tA p.P{KC?:kb"Cp!1 ??`H[҂ .~7r= Հ`m7; .״LA{.-Y B#˛Q5#C'Cj2'ev)E|ºhXInѐ-P.O 9fG 4K!@=|h@ a]KZNң&5Qm-UHbrr焚|RoXE/DBnjvTtrL<9y(= KWPA pQPzNfYVڳ\^eA K@ZDRF $u7 Ȇ4эRJG8U)ʢ4s1:rԚт'aI]j)4I'S5'M endstream endobj 372 0 obj << /StemV 58 /FontName /DFGOCE+Helvetica-Condensed-Light /FontFile3 371 0 R /Flags 32 /Descent -190 /FontBBox [ -170 -250 1000 986 ] /Ascent 750 /CapHeight 750 /XHeight 552 /Type /FontDescriptor /ItalicAngle 0 /StemH 51 /CharSet (/space/C/A/N/O/D/I/period/six/three/nine/zero/X/E/R/M/S/U/G/L/five/T/Z) >> endobj 373 0 obj << /Length 672 /Filter /FlateDecode >> stream Hn888aaa```cccbbb]]] ֚qqqwwwuuuyyyvvvzzz[[[~~~tttjjjhhhnnnmmm|||eeegggpppxxxiiiRRRܪ}}}^^^fffXXXoooSSSllldddUUUZZZsssrrr___kkk{{{444HHHQQQ999///:::;;;WWWDDDNNNOOOYYYJJJIII\\\PPPKKKLLLGGGFFFTTTEEECCCVVV>>>AAA BBB<<<,,,@@@???===777222555000666  r endstream endobj 374 0 obj << /Length 666 /Filter /FlateDecode >> stream Ht888aaa```ZZZ:::ccc^^^颢 әԤ皚լ֮vvvwwwggg[[[eeejjjtttmmmpppfffxxxdddkkkrrr~~~hhh{{{YYYooo@@@qqq|||nnnuuuWWW}}}bbbXXXsss艉yyylllzzziii___VVVܠҷٿ׀¼󹹹]]]\\\ 000$$$OOOHHHBBB 222UUUQQQSSS ===CCCDDD<<>>777555999 {g endstream endobj 375 0 obj << /Length 639 /Filter /FlateDecode >> stream Hp888aaa```ZZZ:::ccc^^^颢 ҙԤխӯ֥kkk___zzziiiuuurrrwww~~~WWWsssdddyyymmmqqqnnnUUUpppfffgggꂂjjjvvvOOOSSShhhxxx}}}lllYYYܠͫ϶ݼ񿿿ƈttt󹹹{{{|||oooeeebbb[[[TTT---DDD222]]]VVV===CCC<<>>777555999  xf] endstream endobj 376 0 obj << /Length 615 /Filter /FlateDecode >> stream HX888aaa```ZZZ:::ccc^^^ꢢ әԤլְkkkzzziiitttrrrvvv~~~WWWsssdddyyymmmpppqqqnnn___UUUfff}}}肂bbbTTThhhPPPjjjSSSxxxuuuwwwlllYYYܡͫҷݽ񿿿ƼàѸ|||{{{ooo///555000444,,,\\\JJJ333666GGG<<>>777DDD999  ` endstream endobj 377 0 obj << /Length 645 /Filter /FlateDecode >> stream Hv888ccc^^^ Хӭҡ___kkkwwwiiioooXXXzzzgggsssTTThhhaaammm@@@fffxxxttt]]]llldddppprrr}}}vvv[[[|||```eee{{{렠ͤùƺ肂+++/// KKKyyy~~~bbb\\\ jjjHHHqqq)))444555333(((nnnuuu111:::222IIIDDDZZZNNNVVVUUUOOO666CCC999777  9fc endstream endobj 378 0 obj << /Length 669 /Filter /FlateDecode >> stream Hq888ccc^^^ ѥӬҲ___kkkwwwiiipppXXX{{{fffrrrTTThhhaaalllmmmAAAeeesssyyytttjjj]]]dddqqq}}}vvvooo[[[|||gggꓓΣ˸ͤ<<<ùƘ???KKK躺+++/// zzz~~~bbbYYY\\\ HHH쁁(((444333nnnxxx111:::222)))@@@ZZZ```uuuEEENNNRRRPPPBBBWWWIIIQQQMMMFFFUUUJJJ666CCC999777  n% endstream endobj 379 0 obj << /Length 642 /Filter /FlateDecode >> stream Hs555```[[[UUU777]]]^^^YYYޘʐˣ̒ͫΠfffwww~~~ppp\\\jjjrrrSSSnnnttthhhmmmoooXXXQQQdddcccuuueeexxxaaa}}}NNNlll___III{{{MMMzzzvvv|||喖ssskkkTTTҽѶƔȸٳ溺Şbbbyyyմ缼gggVVVOOOqqqiii333:::<<>> ((( 222EEE===BBB888999666  \ endstream endobj 380 0 obj << /Length 687 /Filter /FlateDecode >> stream H_蕕~~~}}}碢·{{{|||hhhvvvqqquuuÈkkkŋĪʎ\\\zzzmmmfffwwwnnn[[[sssZZZaaa___eeelllrrrpppbbbdddgggtttjjjoooyyyxxx˚cccNNN```PPP AAAOOOiiiRRRIIILLL^^^111QQQUUU???]]]%%%===SSSYYYXXX888DDDKKKJJJFFFEEEBBB@@@>>><<<;;;:::999777555666333222000///...---,,,+++)))((('''***444GGGHHHVVVWWWTTTCCCMMM&&&"""### Vx endstream endobj 381 0 obj << /Length 693 /Filter /FlateDecode >> stream HY蕕~~~}}}碢¹zzz|||hhhvvvqqqwwwÎlllyyyڣ\\\eeexxxnnnYYYsss[[[bbbiii___fffmmmuuujjj```gggppp{{{dddkkkrrr̜cccHHHQQQ ZZZAAAOOORRRJJJKKKVVV444TTTEEEooo]]]DDDUUUXXXtttaaa^^^CCCIIILLLGGGFFF???>>><<<:::999888666555333222111000///...---,,,+++)))((('''***777;;;@@@BBBWWWNNNMMMSSS%%%PPP&&&==="""$$$!!!### _yb endstream endobj 382 0 obj << /Length 690 /Filter /FlateDecode >> stream H\蕕~~~}}}碢·{{{|||gggvvvqqquuuȦiiiģsssʎ]]]zzzmmmeeeooo[[[tttYYYbbbhhh___dddpppjjjwwwxxx^^^rrryyyfff\\\aaa```kkklllcccnnnLLLOOO AAANNNSSSJJJ///QQQUUU===''';;;RRRVVVZZZXXXWWWTTTMMMKKKIIIHHHGGGPPPFFFEEECCCBBB@@@>>><<<888999777666555333222111000...---,,,+++***)))444:::???DDD(((&&&%%%"""$$$ lx endstream endobj 383 0 obj << /Length 690 /Filter /FlateDecode >> stream H\񟟟uuu~~~}}}sss𥥥«ǩӜŞeee{{{llltttnnnzzzwwwvvv|||qqqrrrbbbRRRkkkjjj]]]gggccc̠[[[iiixxxȃTTTyyy^^^ppp```\\\mmmfffaaa___oooWWWXXXYYY%%%EEE)))...dddNNNQQQGGGSSSMMMAAA***FFF??? ZZZ VVVUUUPPPhhhLLLHHHKKKJJJCCC@@@===<<<;;;999777666555444333222111000///---,,,+++888:::>>>BBBDDDIIIOOO((('''&&&$$$###  > stream HF}}}úꔔ钒·山Ҷxxx~~~zzzՈ𪪪⚚ɝΥbbb֓___􅅅ȡ칹̴ᎎ把ppp{{{mmm䨨tttgggʠuuukkkwwwllljjjyyy謬|||vvvfffHHHRRRPPPOOOQQQNNNMMMWWW]]]aaaXXXYYYeeeooodddTTTUUUSSSVVV\\\KKK^^^ZZZiiiqqqccchhh```nnnJJJLLL[[[sss111???"""'''rrr&&&+++%%%,,,*** d endstream endobj 385 0 obj << /Length 696 /Filter /FlateDecode >> stream HV񟟟uuu~~~}}}sss𥥥«ǪӬƞeee{{{llltttoooyyywwwvvv|||qqqrrrcccRRRkkk]]]hhhĚΔ[[[nnnzzzmmmxxxiiidddTTTjjj^^^ppp```\\\fff___aaa陙bbbWWWgggXXX%%%EEE)))...OOOQQQGGGSSSMMMAAA***??? ZZZ YYYVVVUUUPPPLLLIIINNNKKKHHHFFFDDDCCC@@@===<<<;;;999777888666555444333222111000///---,,,+++(((>>>BBBJJJ:::'''$$$"""&&& ### y endstream endobj 386 0 obj << /Length 669 /Filter /FlateDecode >> stream Hq888aaa```ccc^^^ 墢槧箮___|||\\\zzz{{{TTTxxxssstttqqq}}}yyyYYYZZZlllkkkXXXuuu[[[fffrrrooowwwhhhvvvjjj~~~WWWmmmpppnnnܹ444VVV777<<<@@@III>>>???:::ǸPPP666ΙKKK555333222EEEOOOɶԎȴ]]]ٍQQQddd'''111)))+++***iii;;;000SSSCCCbbbLLLgggeeeHHH///DDD"""UUU999GGG===FFF---MMM...  r endstream endobj 387 0 obj << /Length 783 /Filter /FlateDecode >> stream H  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~ b~ endstream endobj 388 0 obj << /Length 684 /Filter /FlateDecode >> stream Hb888aaa```ccc^^^ 墢槧禦___|||\\\{{{zzz}}}TTTxxx놆ssstttqqqyyySSSYYYZZZmmmkkkrrrXXXuuu[[[fffooowwwhhhvvviii~~~lllWWWpppnnn赵۹444VVV777<<<@@@III555>>>???:::ǸPPP666͙KKKQQQ333222EEEOOOҺȣ]]]ƍοddd''')))bbb(((&&&jjj;;;111CCCLLL000eeegggHHH///DDD"""MMMUUU999===NNNRRRFFF---...BBBGGG  aux endstream endobj 389 0 obj << /Length 212 /Filter /FlateDecode >> stream HC#?6:X}Bk2`"i18 K%8TU04M;(}Ymy0 $IQ  - endstream endobj 390 0 obj << /Length 179 /Filter /FlateDecode >> stream HK @@nFR$iVXFQ` XXf)HV> {<㨪imq,<Ϻa&<ώPJ'A`vYajy*@$ALLӔ8QEeBhƲ,^׵۶YeYEq'I1<`9f^ endstream endobj 391 0 obj << /Length 345 /Filter /FlateDecode >> stream HJ۽ڼݺppp```vvvhhhggg~~~{{{%%%Ѭ&&&000///GGGwwwnnn)))444---===၁111***:::EEE333222zzz;;;HHH999+++555yyyMMMiii^^^dddcccYYYmmmԨ}}}lllsss 3tɚ endstream endobj 392 0 obj << /Length 342 /Filter /FlateDecode >> stream HGܺ^^^eeefff[[[***{{{̵GGG$$$ÇYYY|||vvvЪ]]]gggɰnnnBBBcccwww\\\FFFDDDmmm```´늊kkkttt a} endstream endobj 393 0 obj << /Length 333 /Filter /FlateDecode >> stream H>ܺ^^^fffԸȿiii|||eeeƳĕ333㯯ϖVVV̜LLL˓vvv\\\qqqɆhhhtttgggsssrrrEEE___PPP'''JJJzzznnn섄kkk APT endstream endobj 394 0 obj << /Length 279 /Filter /FlateDecode >> stream H޹aaahhhӕlllnnnܞHHHBBBCCCPPP666FFFRRRmmmvvvEEE~~~111{{{YYYpppwwwKKK[[[jjjIII<<<000333տ̯^^^___SSSsssiii맧 endstream endobj 395 0 obj << /Length 291 /Filter /FlateDecode >> stream Hܺ^^^eee౱uuujjjccc<<<@@@AAAvvvNNN___ճ]]]pppʭ>>>}}}RRRMMMGGGQQQ|||ˬ"""000+++666BBBlllZZZUUUfff\\\kkkttt Qx endstream endobj 396 0 obj << /Length 681 /Filter /FlateDecode >> stream He888aaa```ccc^^^ 壣槧窪___|||\\\{{{]]]yyy}}}TTTxxxzzztttqqqSSSXXXZZZmmmkkksssbbb[[[fffrrrooowwwhhhvvviii~~~lllWWWpppnnnuuu蚚ܺ444VVV777<<<@@@III???:::HHHJJJPPP666׸KKK555QQQ333Ť222EEEOOO؎ƌddd''')))(((&&&jjj111;;;CCCLLL000eeeggg///DDD"""RRRUUUAAAMMM999YYYBBBGGG---FFF...>>>===  Nu endstream endobj 397 0 obj << /Length 702 /Filter /FlateDecode >> stream HP888aaa```ccc^^^ 壣槧簰vvvwww|||yyy{{{rrr~~~llltttxxxUUU}}}mmmDDDjjjiiiWWWdddeeebbbYYYzzzkkkhhhnnnuuu\\\pppsssqqq萐ooogggۺ555VVV<<<@@@髫III444>>>???:::ǸϖJJJPPP777666XXXKKK333fff222EEEطҹ___TTTOOO]]]QQQHHH;;;===...111NNN[[[MMMLLLZZZCCCAAASSSRRRFFF///))),,,***000'''999---  GGG  K^v} endstream endobj 398 0 obj << /Length 771 /Filter /FlateDecode >> stream H 888ccc^^^ ХҬܺӹ⧧č{{{~~~jjjtttuuu濿sssxxxyyywwwԦŀͻ´MMMzzz>>>'''```;;;DDDKKKVVVFFF 999///IIIYYYEEEUUUlll###TTT666mmmaaaSSS___ppp444JJJrrrXXX@@@ PPP777vvv휜 iiifff[[[򂂂:::222LLL)))555WWW000 ---ggg&&&hhh???$$$𖖖|||dddqqqooonnn}}}HHH]]]\\\kkkeee<<<***RRRZZZbbb===QQQGGG111+++NNN..."""BBBOOOCCC333 !!!AAA,,,%%%((( Fw~ endstream endobj 399 0 obj << /Length 741 /Filter /FlateDecode >> stream H)888ccc^^^ ѥҬܺӞֹ⧧č{{{~~~jjjtttuuu暚ssswwwyyyԲŁλ󠠠ddd薖!!!´"""eee___mmmaaallliiibbb}}}hhhnnn```zzzpppkkkvvv\\\gggVVVfff]]]OOOoooZZZUUUrrrqqqՄ***,,,xxx|||YYYXXX)));;;TTT<<>>&&&SSS///AAA---'''+++222111999555444===$$$MMM333III...NNN (((@@@:::FFFPPP###000BBBEEE777%%%GGG666QQQRRRHHHLLLDDD  T| endstream endobj 400 0 obj << /Subtype /TrueType /FontDescriptor 401 0 R /LastChar 245 /Widths [ 278 0 0 0 0 0 0 0 333 333 0 0 278 333 278 278 556 556 556 556 0 0 0 0 556 556 333 0 0 0 0 0 0 722 722 722 722 667 611 778 722 278 0 0 611 833 722 778 667 778 722 667 611 722 667 0 0 667 0 0 0 0 0 0 0 556 611 556 611 556 333 611 611 278 0 0 278 889 611 611 611 611 389 556 333 611 556 0 556 556 500 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 737 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 722 0 722 0 0 0 722 667 667 667 0 0 278 0 0 0 0 0 0 0 778 0 0 0 0 0 0 0 0 0 0 0 556 0 556 0 0 0 556 0 556 0 0 0 278 0 0 0 0 0 611 611 611 ] /BaseFont /DFGGNJ+Helvetica-Bold /FirstChar 32 /Encoding /WinAnsiEncoding /Type /Font >> endobj 401 0 obj << /StemV 133 /FontName /DFGGNJ+Helvetica-Bold /FontStretch /Normal /FontFile2 402 0 R /FontWeight 700 /Flags 262176 /Descent -218 /FontBBox [ -170 -228 1003 962 ] /Ascent 927 /FontFamily (Helvetica) /CapHeight 718 /XHeight 532 /Type /FontDescriptor /ItalicAngle 0 /StemH 140 >> endobj 402 0 obj << /Length 18090 /Filter /FlateDecode /Length1 30660 >> stream H}llea|p ]sM0]Jw>> "Jk#E䣨Gt4IڦmTQU*6;M E]o̼7T(w˶U{K~{{s#qv1/(]#-< 0Pql#_ @CWs/?9YCXPd@c~>WGZ/} ` ЗCmXK) isJZP ‡L/Z譫[Y[V0NNl z:4:z П৴@R*|E˩Sz=WWv:nF`XWPBX#d.xdUp ~ ?pwkGmr]Z-JCpO8]秭p"H4`˵IUj#P9N.Du'+A 4} 70 /"^{NhA}ܠ']>`>}'nQ RNJ[= p]G{mhC ԉv&kס7=KX/6c+C͢9955 :w]Y)0qd7g\7a;جl@mYAhoׯ/SFL6 ^~D"c%o gۉEaODXb)Dg+dvuZǯJp8<$W-5H~w4NcS?, .GW^YuM/,'/ȣ}q*M/˕'b@ M_8\f{]CILh^\t+,jm]Ҝ^>].2a՚Qhkl1Sǝ6 )[ce(ryXߞ q!qMsi B=HĤЄNye&sBsZ²z_P3ɋ01] cxB2__-/oN7_輌O(cW/D|","^8<OOM-lO''!xbg!O|/qJv 9Dx"s#D|Q#c&ħON#፶G{jC$m+W3gI1(Հ'±ubNcϰ*xCƬ&|c8cwpn@F^XmV'0&,je9Iᙕ5`|ؠ$jS.<c`I.` s%h1O[)[QL{[2gܤ_~kov=Q[x\K]$?Lr%ɼWɀM4 aK1VjLKXEV%>ms?v8i9rT[m{d +ToNivM/U}w`f-  ֔d:B;3e1+U@5C;c 'Cƅ(j>mr _FV9.Yi2ϭnx1a{8IXqZ]29ׅIx|"=SSGkB&`rs<ұVueiq^QH1$5>gQ׹87𲶞|#HQ7AE^3{a^X4kQsU{}}?q㾙(5[| Ӷͼ}M䥺3Iȣ\?׮Xx{{J-y'#!\y`.ڹuWh?++9=!';2RLp}V$YyQqK#4(w๪?C ȟ8to O4_5ikO>-TBS҂;adX鱺( izqNGِH-ѹ+B1"Qӊ@8{+i  2udW[^@[U'z?jlώ׶φKW_\#nY ^ǭKg6wNI*:bpv{ZTT֕~P]t/]teekN$wGv <;lzߘs*|q v&O9X.lkVe>.uOrY/4PE8Cl½_KO^jzd]64wO#iOxkC gK0$7t<^E`;-Dm >k ĀI- kQ7ݗ$(1/}3z1Cw |onS,51 M1tOIa MI*#nCNQ/`P,9)'0XḿN-f/߇uD ?f-0;b4ь!=du}h^}slьP6vj j}-N4C!ft$:\i\et5=%s ]~ l6kMTUT[m%iQίĥfĄa6(ledSlmc/%e5SnTܸ3w= [hS󖻙wΝϱ;/?Ƅ&[-D;4bKv?Ic)G+JE`ҪiL- CHiZ[VVL۠Z֪ɱNB~t~}XBI4eDJIxIb]+Ps9+B3ʳf,"OP1b1( M1H:x穁'Hx)3gRW.˽FlSq7 iBn-Z&J hP{vC_5m߰lf{s`B"C2 hq;Xp))<-OSBD ~ +pY77%2aML7KfFwZ9I9%ph5RNm:te- fLm!AdÙ͈=p8!<\^p~jR[pVU+jܟmھWiv}ٽ }CC}}C\ۺN]x̫nz扄rۥC[Om޶ms_.=vk흿Jj-VǃJ!b42xm, ȗ)|3B0I b!VtbJl 9K9U/Ɗ;cr9%9ǡk 9"roj [6MrY~/&RP"E=JL] ZZ@M:@kJ#@VB'y9w2X 2N*U w{c=Y/.đK1woG:24ݭsK8b>l2kgslj%I?i] eŭǧr*T  O?п(nm6d%;Ifō5JԴQ}UXlt XqGP8BMɵGwqbjEp*I.[&qa\2M!m?(.)#JOzDUY(C0>jIO1ٴ) )01y`d؈ lbYhl VU dQ mcDB4m)pbL% ÂÂAyc9!jr-{G<3ש x|;kNosk#4> 2r|a1ŏ<`(+qPLj0\6S* (*D| E -e2LI:Z)e"dRCdE$edZ("Y"YfD\$Kz* OR}84V!*ry$Y3Ŋ%1hDぅWǛV~h;2jٽ w[d8xWٗ|泽sGv爲|_Qwx1|-bb(:ӈ<шazF $*#ϚQG+C#æ`'hƌF)KGa(:|3$Q',Z_BER!znH G(3~- |Y^ ;08^k yB`! g{aQjBQT9ڍ@LU.+A)'Ǎ6ڿ/uG}㒋c#xĿ|8VN<|I{7dK綿8]Jü*b/dn]Ф582]%C$-C4)pDsr{)sV+T1A%JԢ5}Ra_Țj*t jc`&`r#5;@gi{8g}ܾ̝'sssW4f]_RtjcZ ,KO/AAzY(~2\ %ϖdمrp}3ddfSH|P;;kWA։8@6yid!VO>f/:u4Y(I~3 HnLz}.Ǵq;WQ5]Z5Zp5^@x N$y%`];uaEORF$|Ÿc8a|gllj͙$(P]F!Bimuֱ *Pjc V:uMBf6hET&Jִh*;im_}}^x Ed=xgH_a#[ j^As}) !THHj )2jd؀L'`lS=F9B($3`DK]smg0NF߲cxXGlڿp=|־swc_|\mh:C]q0kySbǝs>@03Q0rQU?S9+JL υT{ `$" tQ`d$a0MN,zV i'8\9Gԩ)Wnrjrrer3W욪q7=` 0ΪKbr,8V`/އ%!0wd:8`qX$>v싐H8֋ f(2hhp|"iFtrBb -L?ɛ7WƍgBxs=}ˉg.D))Q,yk(A(r UfFQe Ls< 0_J'p<>@i|iMG"L*O9jJrO!BJ'U 0s\;&NNNV^L$:*G m+BCbPDtT,*!(531V҂ 1~}2a+ERLPuR;b{^oV,0[ [70b7ו1GcN &!J"%5 >&f_Cx ފg/^|iOe3{/`m ovC&ʠyAŐ>[nʙ g3`c,D!ZQ`Q )6>QQp4j ̃crqǂ˸(J`͢0pblj &.<?л}<7\82pXa~&k \j7t)|KEwÓS`sy>TxfϦYkxֿ* ?ќg_l={n>=K8pw?;^I,xXF}xÂt-,HWYlj,H-eltF!Afٙ|Hh]7n(‰Nʉ4N8ёN.r +Nd2%3*:cVP2&tc% NOCB> N'Ȏd8d=~6Rrp,ׯj4L x./JWy8Wtk]Gk?c?}3wިo3ڙ/{bw30wtN<)jsԸd·%j :E}+=E#},J+n9@'%3&dBvG&,i2!ݿkcHTu J[_`A--t{NI?Cr #@@p.t׾z폱룃{W&ӳ㱯E{ĉǡSJ+뙖ڎj!;K`IE9 : P`s<{6̢o \?Œ'6,EfXwFٙٙyٿk׸-(t] rx"T\L\34G!dfT~gHb⩧.>;eSywy>g j,J8P%$^Y >%QWD|X!30HT *Fh -HF@x sqBqօg.|TX?,vӢpn쏮 [={+FFRRb$JS1vД+{`>I wGnN铜/mhaA@B˫p64BH^ԴpDi~M &ujz`ې1WگHx/MfL2g@Ɩ${A*t'U!BJ $RstF7A\t.Sφ iC@ ȕbjC yͱȍ<(N.%rw].KUnT({aC &rS,Bw#=dA\`=^۫ br$|nE@`r@`&&Y Q`)V؈=-{=]!8@Iܔ ɀUsd&L Ӣ!4fIK'ժ~~ Nܼ3ж‚JjzRO%LSn¾,3#+:xg Gv<˞̎$L2]J/=o3o (mN|+o;έ͍o렽F]sq#سey̽{x_pr/ʽHNvr,sO5cf`7Pt" 6S"% ՓTS0SGby=( AZ;k =R xgw޻Gxtfȑxgˍ_?n|x'.Z ߿ T$ݵקHJ_4^3Q 1yn> a/<|Z>7zLb%ILGX444?ՒHGt<@/FC0lC[zvpP- h!~7#0-qǛn$ppCIrwP1Q"*KFާ AcSUn}hS{dzteG^թI@盀NCIJnY7\3!t͒ҭdY>|[xO$sxyN79O;C B9Hɜ`oLSxH M_Hr:GK$& PpAxi:mOO;4I(b%A.UJIh,?i[<>sx葙Gi:cZ)s:NX/\ Q,BʺH~!HEuQ[Y’ V3U++ C5H5ޟ),)WȒl#ǶɳZsL$GX& BE''go,n%9[Qܘ23c+V4q!kjz>\{ W4\<7LKq22Cj^2yn˃-/l^؟6‣@<,qN:؀1Y~:kOM.ZWyc 7>}ukӁ%H{m|ɞ0|} 4eahи:Y#F'-ȑM٢֡xK5%E{Fu>\$^rR[Y)^kxx:+wsLIs:aU+Pl אUO~.fwҒ{%J_I}<} ;C~*%`=Hi B>sl/ V /Uuw<;xgk6ť@`hl(AD!CXL %(E/UB;c{6K (CVUUoVjZ;;c{!z;ws U]P<_wЖ&yncN36VjDeh-*YbDmRir9K fp.<g0aęc?g'7| g&yg~'EF!(U%>Lzɡ EUmF ƜH0% Z\<ۑ=f;`Ŭi yV lGpϖ2YL$ 7_친?6@3"B,ȷ 4j}tK+bJ /eïTLUViq۳믿?vt횧vČ+iZ;oo!{iˎIW&XdHfEF!z&\llw !c@fD$ 豤Z:C j֪k2ln4#ODBznR1R aQ㓈 עO"*{DHdjVcZćq>dl|W_?Z<:[Z:fV]V⑕S>*}%%2R0Mu`VC˥mxf9? ·g郚e"ŭT% IMJ{zI!mn= bCpp=nl8qph,=0E9wF.Y)Aɧխt͗xS1PqŇ3u*_Btm>4|=`u,ѵ75;;x \XwTpvY`D$gEɾXϵ7 [A9 +plvEf9 m#wa@(B33r dC7ڴjgZqUDִ!D D-mE e3qdNOYSzqK{nqȂ7|(9Slfܖr[{ H&~CU}}h$\#jV1d$W{EBQnϳo{j7W|éo{?hfv]oپ{;_犿\r|hE~,tzN?ʁ<"]FK:t",FXZ$Yf;Ȩ0*!0hCI2jsR&]F8,ɒȨ0E4pr1Z ?Q\;D)1G5QJ=ОbQ7#K9+^7=X]$F+}y}+P􉆰rnt{DY K6.?/M^X>%7jR jm܀fþ@[ S`NmI) Ј3Cb3=nٝ[$x~GL)UN.FFJ(9@W~[??_ŊDeFZnıxY\4 xՈ"[ L##&5M2[,/ǰ0r"ʐOJ0eE<,6MEE(f*M(@DyT&_zוzi ،ќ+HKҸom^q*h{.'If{.=n aPTdҭ6Q׃]]]я?|x7G}c#GN?|:_o>quЇ*Э5iqulԬQsĆ4ugL0"0J@ >DQ3БihC9`4C{a ü+,$DO=aL͚%KUҽU=U]JROt>H]nKA ݻSέs$yJsC;rtxSͨsy~;l]p9V%G }Wlib.4淀15 ߨY蒲s>]ٮ%S]V;ȾWNH% 3,вLA5JUfrW%N)7OD^$iG+{ŖÜRN0N\I se@{Uoh}mq޳ǙR(!IVx:8V}ͭNP4AEc]ឯɓ׭a~|\l<œie-biҴ)SOtW(^QrQ/BlD?EvЕB"H%7& vJ(& yI@u&D!AL\@>" {]0ĕ݃(R+$3 h6\x/4sQ_ޱf1"QHѿ(hV )wBRqVOr}L7hXvpD8rРc ~j/A#F,A8KAɏ(qITw!E#hDfx?qْ~b{&vH6 >~ ~ѳvYG]oê ]֋rNs{8wA (\ҝs(ʲJ7C͐%hd3T )04b1idԇ&[LpdHvD7SvX,UtX΂l5tq>5(zc3{NэA_zm#,C ЉTr`?vrZ St9tJZ؝ }!ekii3($XF\D+iIJGeEaS2NYj#o[)]$ Cb LQ-Q"aH.qHC/4u,cڼӓק7/!a\cn rE%(.IDVyV^IAĮ) 1hԦ)WeE-ZE&>fcy$`9_`HUPSH>Lz{%wk_1wO>vx?>ƫqw XW0N}螝A3= 2^7{"[H1jҊJà" )m@)E= .[K[Ui:y"TɌ[ga)1MV$Tڅ_V (%()!]h~"UK&l) ?KjACp,-L KBMB% 7BQJ32R&3Go~Ժ?~ʆG Y^ͮ9|ت\p;;3o\&qDB2zC@{?6KZh$ [.@gS1\a1YbEk.@ܻ+1x[N[>>`LEF%fMp2Qd4IsW2;s G]SYUTo`7`(B`lEAkGa2T) %9 V'Q'X#Z*ºA VAbv%RjfI`'tWt"]/aҊ<`+xa%2ޤq|g΀Ee^B\>V.N(u@D㵵"W{"垆ި7 )Dt( [/fԮs W![l ȴ"[VHEoY t,#6\ۗx31CRʤ&Px꼙:2tm]R.ߓ=Ń]tg7-]ўTSSx{ep/*s G4McK̥9i4[yaXwxbX|1 _籹j^qD,Q}שT9cjcڪ{]o?hF[ڎ~ZXe JanȘ5p5R;gď0e[f2u3b@#eQclޖ~MƏxp{yWaF\ʰ)%Hr#IȫxU)$ENJHt=%Is3" Y -xKޞ[{nJ҅gY9V1ޚ2G]x.`P Z].w)]i)]虌.4Ht& MN *zTQ}xr.z/ p^-hB~ ʜVfYeBS)0 6R0 1b,ےiT2Bf9GcHK_֭oSF̐1a4CI@3d ]uʘ$'Øʟ'g"  @xkyƾ"^ս" PRo0սBFԽ\Dժy`?~@F٩!h@-1 j:Y?IcuWU,RS^V5JKe\? Zf;dGաj[>4]ck`1-6RYzxlyj8hjB YeMbsy"JjMY9iӆjcR[ߴ,,luuzq] WDa4 /8!5&}|sY4[4biz]abί >y ZxV<wQa'yJ|M%1* b1(j3D%+%xzA#B"H٘¯-RJ%bSՂMlHH` &hDBpO0D .BΞn Ǹh06|'Gc0!9 #o-7mL '-r8+xA|Wpu6 c689cXܤz3xǢ.|;Gp4 ad3H̱v݉ DI8-t([L‡H4/]q $e 0 endstream endobj 403 0 obj << /Subtype /TrueType /FontDescriptor 404 0 R /LastChar 245 /Widths [ 278 0 0 0 0 0 0 0 0 0 0 0 0 0 278 0 0 556 556 556 556 556 556 556 0 0 0 0 0 0 0 0 0 722 0 722 722 667 611 778 0 278 0 0 611 833 0 0 667 0 722 667 0 0 667 0 0 0 0 0 0 0 0 0 0 556 611 556 611 556 333 611 0 278 0 0 278 889 611 611 611 0 389 556 333 611 556 0 556 0 500 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 556 0 0 0 556 0 0 0 0 0 0 0 0 0 0 0 611 0 611 ] /BaseFont /DFGIEC+Helvetica-BoldOblique /FirstChar 32 /Encoding /WinAnsiEncoding /Type /Font >> endobj 404 0 obj << /StemV 133 /FontName /DFGIEC+Helvetica-BoldOblique /FontStretch /Normal /FontFile2 405 0 R /FontWeight 700 /Flags 262240 /Descent -218 /FontBBox [ -174 -228 1114 962 ] /Ascent 927 /FontFamily (Helvetica) /CapHeight 718 /XHeight 532 /Type /FontDescriptor /ItalicAngle -15 /StemH 140 >> endobj 405 0 obj << /Length 13777 /Filter /FlateDecode /Length1 21740 >> stream HoPT} BX}yDe>\FD̼Ǵ3좐Jj'33ĤiMKj.CMiMgN?$:t4{Vdﲿ{= 0(@M=9=2] v%s O@w:Cg 螽[n@ֿ?П^DSXXךJ9:x􅅘: {eZbXw(}x`s!ݳA0%gޚLG#ZMiGfeм +`Mp1Vj8ÖMl1 GOt5ݰnaX-YG0f56a7_ݰ,?ū0Oep>*R8E`%3NϼeeZGۀ,zb[;;[ڭomM[[6o^i͝#PCp; /Y/]R2PQ^\iɢ |^ E¼u;H_*$ ."%tْ Fs]ZP궛uigun g WѤ"s%3.arY*%X)a;9Nudwl:;lߨju-;'5\*ˣ~|.Yj~Xgu3uGP:*ں>W&+;p767Bhrbpfb T'FW/q33=aHQ-TZ K k0 []`ki$e0Mc:s#1G`tr0+a%ZYֲP-OaHѢE0V.pK$,`;F#I8 Yk-dj-M4XSHqeq[5O-Qj}GC(T= |j ltSTV  ;\fJ.&&suojӖǽ(+1.й|#9e,rrr5nBW ͮ.kB~Ukkղ!F &ust, աqģ["a9.]ZX D%F4BPkVha$(W_&D$jqf?Q]a{x\|e4 zUzAEojy,jDUUL ;jc8V m%刳;4Ҩ -'L 0߰gFvSPYbaYգqSX}E F.i\\t 6ΗmYdf3$,r><)j;]6hY o 75(5))n = 3i?"!e@|xx{+ma2~G-%o牿&xxK"8 F|S Oܦ$q4y)y_!އLACnd쳬jdNO'#>F|x۔1G&8~eJ0tP'0ƃ,h9n3+amuʱAvx͸ C¿5{)]Pi "\tU`wRHKO7_tۜE9DWywsEu"d:87@LP"^!=WX*s݊9;Uvvv+.NH O^Ǹ|$!.%y&dޥd@Y&|WU~E_2| me/B94CW^u]g I Ә>ljs㱵- ZrS@',\:]pALh.H,tvgrˠ'LJ*;^<厍V;|hBnIX\Z專dDe{MVLsqG9H'NZeS)4þNgDs_?f[/Fgj*Y&+<3>1FlmyX{mc{(au]ʥ͆&h#9c.DjIalh"1of<] hˀI<:s 0-+6f,WIy;4)a/? C RGik[r;ջwx߻`X9NgCu Ta?l6X<]ϲ۔LN{JX b=ԣܖhm֍ƓP-dJSD6\-֠ %Pդb Qe@G ' ekG}œ?9q4W?\* C7'S/=RIG饆O<6-픡7t<Ϳpz)PnBHytjty9n_(OJy-;~QKO++3\RV]RFn}ZVё;Z*UtHw2SG=SjW}n##{܏P1[5*a,atZ *+`i"[mxٛe%~,4xgJYE1ٳ%[';p{"ʵY_M}k<_<'kG.*CL4f4:u#G&#nQ @2E.EqaNY%%<٭ɤ..4RTSxPI&X,$Jfq(}HZ"]\G%.XIWikaVO;\j K&\bm%MwހȘ̟;} ^pxuKcts?Y/'7 "r)\ KAU:g-Ӱz^|fuȨJ1XiE_~8 2kP~SX(|tΚTMKN6cNmp/ٌ[B˃St!QLǪ(XЋ)SPM0g^f;u&q q$e_uݽJmi%ٲ#CydqhL)Ӕ[I'5Ïi0up0~j:qiia#t2{sﮀZc>V9wЅ4BVPXQZkZU,6WK&lhվ axߧ7ʌ; <=0pǚ cfXᶏ ,ԛWYx=*wV٫̞4mU֪4gV%A5]ҭY(֊Za|Z^Y&) RKXZs}Wh8ăܷrbKi~?xX$F.޺yxGx2Et~Zsqū+elnwV3ol]w-{\T FiE3eQA`"Ÿ4D2Mk380MDt[7If$q%`ꨵUdHKIB0qd ,--uu-O,z 3Q2G9{rN[O]?E[G ޮ?4ط mfi Y[nAX<\u|~ۭi/KUC$G`F ntQd&" Gd~K 'o,ވW⶿_ibP:,lM`T׭,]n~RayD<(x=5V4'D(4\@gD$"*uT#~+(>4.G@!Tչ[ O꘽œ_MD`@e7=IDxM'ǣ0Y(SSjMЗ-ezhEMq¾ } llDA5 8 N B3/ktqܮݽҩx:?.l`Gjɜm!SHl/BI4*u MXFTf|2*[Ǔ9Ҥ5$3u@ &'S12! (߈FFm %ʤ=>Ƭ[н`5(%Z+oҩ$C۶aU]g yP;>?j 7: {vkIr}m/.  CP~`薫IN\WjZܽ.[=1'$KZ0i63XZNf3 .l5g\Up\O^( d!Xe'~:ϐҒR<Y@\)ńt/OB\@a){:`ْb|ҩkW:mK~zraItAfsPs ׬C=fSuיA^ \EaꪅXXLVXHX9$|~-ݍZ;" JـcTǰ$NmB&xڋj5CD{a[bleN\/[T}ܕaXdSg5 A2 A'@0z`AОD ^EL0` ∃Ya Vn";x0.)NNn%(LxD$Jp4չ^>M& SOKO 7Ao 7՛,qڦo\tsfke=s3 m[m1hTU#f ^* ȸ1R^xe y0ua,48GcW@[:BnW) X'-kqbaF ?Eaוh3sC+7v]G^_6w7Y@,QuYi`C9)`ʼn"vv5(nCUXXl+R³˲lRÕ 0è}vt'c8X펌U܌ p^q9OU*+n?sPIx" ^tYŴ9FX=2S̲S:YvTg=NiETog)I lY0T2rBgSB`-p[9`,0(Z B_ Af޿iQp[j" pIW6) Nt~i/s>o}ƼIesژllJq[,G y-4i<ם6Lǝ5m7ϋ%<62_7.\D8dz/p#G.S&h҉N7s+gGjv+خ&;Wlgljmbs'MIJ`e@5#JR[UkWu`.uJwƠQk>1-k3uiI[дILS~ח4e# ~ÿ=!g99dOÜX?oBX0E^ 02[΃M *!HWBr# FQ!J^bflwu:3_\ST9t9spk8mJk> *GYOb}> O7ȟϪӜ\ON 1i/D\JavLt0"iV+bRP".VT ȜIH_tlBF͠)` 0BJ*qȡև{}ؑr.9\3ִ.mu[pVt*W9Õ1׎G^<,l6;4o5;¦uVA[ uqN/4G޲; çg-3} ؕs!\PTa9 X#)5д(h1EѡbP%"YtlpBNs42;?0EF#w/&!w+8}W٧JLB;5)qq 1RTYԕตqaR`'9'ثJJr])a ֬ ]ũǕ<@ '. {=t/P۞x]S̺]w>[{Ǐ3:V~mrqgVo_*=}B[M q;،on4ؐ'kkVmu•+=e,|@$ fkF7t>_[WuZy݄E+_5 18`OxauRs<\@N#MKS g||KMv/!ԐCg6Kޒ6FJE_5%V4cD5+ ss.OV%lyA_^6 ImST2i%$- vSjǬ&t#l6\ZN6Mz4|.l,xC$Mi"jFsπpLc%.y3>`4h0N4I,6d+OL4K [fIF}e]WtNfXQ5jw@+.>mB3UyX9"F է6yj+%e ]?tE軮TJzr}A;ڃk!+vcϜ٢/3[)mlٻXm4@suæzu5oM١=y(٩P[CpۻZox*Z=;ްVt-_y0М}{#& gdu$zc[0-q?n՟~`S)Al,I\ǨJ8SM씰R׍LфI8un1p%<G\@"衲n+4,b@ w2Gbx b#Mfi(ฌw_hVN mYI*xT=R۩7GG;R6ϲjrNޡףTʴ.߬J-WU)yha{; B:dwc6 `(V5 ~KisᡧFbu` iC N ^gt2kVi!*-5(bxIlA"ZK՘XTma_렒UX?[ٯsi KʟM[9bwn.NdԶWIg?>.sp̻g?64 ̋R̛  D^7\3gu 3քfn46!}qSLSqF\? 6#?Xp1ApPA|uoYWz+qGp#~+!sy Ht5K^ z/=SƱmo,s8:>ꘫ#?<"/"G P[ q'1YEz,4[Yӄ Bl݈r2E H@stER^Mg};/N9؉ uThIHC)mɆ*4@ XJ%6TmtR.M:yKDu!M+Qy߳Mm,yy~_:A*60cw"TU,jKGL? >Wݙaq3oX^ ݹEnWPW.n_`ӱ C{CBwۺ>JVX54l4GYk0 ?ڌ4NGu1h@­{Ŭ14b1I2{sr9R'„edK sz*K[\:V V=\^%UV*7IJ}V/)s֋ER!ky8X@apbxdT)Ws?h]B{TqƝӽ'oGm&(XQX>(ECG~9WrXKM(vҪ3VNqOI)Mr0 DQíTVBLNJ aJLA5P'ɧ d2`SVTE-#ڪ$+F% bN<=FbLѵX=bKc0.@S%B])qeNK*nM ܆2%Xw'ىSk7j9z5{}ѿ,kmL[#5~9tt0o5( :NRe'Sr&7aL:Yluʛ TO`& ˜VUZ᛬ }CC}ێ $dn PղT(ƈql̥;h?vHgȱ w!S~ˣX=%$Ac$Uq.F!n!-t%1w,&UI-QIRl=HKZ@e\D_uE'QcHt bIl4\Fs{#U>I?*8B [['Z"-$jU r-y#zj^G6lW =# s!II \0URР, -/)';W$0+/zGF\E̱uXt_϶&g<߬}j?~Ϡ'2=K=/D=q(2퉿ZzO # l>w8*,J>Zz˥J>HvN7Y;=jG]s;}޶g7U}Pz%Q1 a%$M=BNT;MNw`w;y&#L_7O'^4T 7?ż9a| spd;h2mt@9P@O w x/yEJx6n#u aP -6}bP.3+kXD-*Ot\{&#ICWU#HgbG4'裆=H$&Hu}sf&M7!@'C1H S04t2TJ.7Qߐ@rd3(/},(!5 :1m#`.9*AMD8" xK$$( SGbARsj"$%q D@ BGq5=O gg 9"dyM]@ j AG E 0Bd IČ{DYB"HZ3\ $™Pݛ;x-'D6_{z o4Տ 7?|G/fqW>k1/XOH_6.O/l Ix:si~rqIjS ~[=9c̲`31{xfwaX7a Qx,ϩ \%DrTFD1]p\>&.T( KlR."FCʓ48> xv,k>}%nc4~?=s, 3d,a2+ocGڋ,+rPլ jm*߹׾Hm%^-iy4i &6K꤬H1Tn@յvz5F4|y-E{o+#hVQݡh q^yw ;^@ D.E7jlj +js#eגM̊zjW#dy&'!E,\ hYt DV dRpP`vӂ58P?4wˑr"]yU'ŜdTiǔ%6Qm:%jΛ"cosSz=~|ϙW~%ֽ=Ƒ zzH𙨮'BTS-=\OKNsuj3"[(mDB*_'@Q(J: (8QD\2힨v1sG-#8'\X̩5oPAwB,Ik> =|EAlX*$BI0l8lƱbkc0t c0猡Pd8KzӑLjجj޺ܛ|Zo_xN]PEYzt[^ԟ} ƾ5+7yncOq`nnE~$^'ќ׫V *jjȋ,[dȢ ~04T.ڹ5xs$"J E7Xw?(\GēpiX#X9͕67?GlQoԇ,a24`tB%K+-yALLX^x|I gyF|%׉$sSv7iT Qp@E^+zW=#JTZ~2#.w]H㣵Ǔu]=.gygPfe~ũm1 v~IoX mܯuFpM.^"-^܈\pph GDrUv C-筒`]mq26nl8]aS{R =^syc-Ցq6.FOũ ]UAx/G@g̫ʾ3=D].e y˾+rt\f9\brf8÷/OΚ^YsVR',Yl3 W8(_